Arginase-1 (ARG1) Active Protein | ARG1 active protein

Recombinant Human Arginase-1 (ARG1)

Cat. Num. AAA7115158

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Arginase-1 (ARG1); Recombinant Human Arginase-1 (ARG1); Arginase-1; Liver-type arginase; Type I arginase; ARG1; ARG1 active protein

• Host: Mammalian Cell
• Specificity: Within the immune system initially reported to be selectively expressed in granulocytes (polymorphonuclear leukocytes [PMNs]) (PubMed:15546957). Also detected in macrophages mycobacterial granulomas (PubMed:23749634). Expressed in group2 innate lymphoid cells (ILC2s) during lung disease (PubMed:27043409).
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: 0.2 mum Filtered 20 mM Tris-HCl, 150 mM NaCl, 20% Glycerol, 1 mM DTT, pH 7.4
• Sequence Positions: 1-322aa; Full Length
• Sequence: MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK
• Sequence Length: 322

• Species: Human
• Tag: C-terminal 6xHis-tagged
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: Specific activity as determined by the production of urea during the hydrolysis of arginine is greater than 30000 pmol/min/ug.
• Subcellular Location: Cytoplasm, Cytoplasmic Granule
• Protein Families: Arginase Family
• Classification: Other Recombinant Protein
• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for ARG1 active protein

Relevance: ARG1 is a member of the ureohydrolase family of enzymes. ARG1 can catalyze the hydrolysis of arginine to ornithine and urea. In the urea cycle, ARG1 catalyzes the fifth and final step, a series of biochemical reactions in mammals during which the body disposes of harmful ammonia. ARG1 is a cytosolic enzyme and expressed widely in the liver as part of the urea cycle, while it is also expressed in cells and tissues that lack a complete urea cycle, including lung. Inherited deficiency of this ARG1 causes argininemia, which is an autosomal recessive disorder characterized by hyperammonemia.

Function: Key element of the urea cycle converting L-arginine to urea and L-ornithine, which is further metabolized into metabolites proline and polyamides that drive collagen synthesis and bioenergetic pathways critical for cell proliferation, respectively; the urea cycle takes place primarily in the liver and, to a lesser extent, in the kidneys.

Product Categories/Family for ARG1 active protein

Signal Transduction

NCBI and Uniprot Product Information

• NCBI GI #: 10947139
• NCBI GeneID: 383
• NCBI Accession #: NP_000036.2
• NCBI GenBank Nucleotide #: NM_000045.3
• UniProt Accession #: P05089
• Molecular Weight: 35.6 kDa
• NCBI Official Full Name: arginase-1 isoform 2
• NCBI Official Synonym Full Names: arginase 1
• NCBI Official Symbol: ARG1
• NCBI Protein Information: arginase-1
• UniProt Protein Name: Arginase-1
• Protein Family: Arginase
• UniProt Gene Name: ARG1
• UniProt Entry Name: ARGI1_HUMAN

NCBI Description

Arginase catalyzes the hydrolysis of arginine to ornithine and urea. At least two isoforms of mammalian arginase exist (types I and II) which differ in their tissue distribution, subcellular localization, immunologic crossreactivity and physiologic function. The type I isoform encoded by this gene, is a cytosolic enzyme and expressed predominantly in the liver as a component of the urea cycle. Inherited deficiency of this enzyme results in argininemia, an autosomal recessive disorder characterized by hyperammonemia. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011]

Uniprot Description

ARG1: Homotrimer. By arginine or homoarginine. Belongs to the arginase family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Amino Acid Metabolism - arginine and proline; Hydrolase; EC 3.5.3.1

Chromosomal Location of Human Ortholog: 6q23

Cellular Component: extracellular space; neuron projection; cell soma; cytoplasm; cytosol; nucleus

Molecular Function: manganese ion binding; arginase activity

Biological Process: response to drug; mammary gland involution; maternal process involved in pregnancy; response to herbicide; liver development; response to amino acid stimulus; response to vitamin A; response to manganese ion; response to selenium ion; response to vitamin E; response to cadmium ion; response to zinc ion; response to methylmercury; arginine catabolic process; positive regulation of endothelial cell proliferation; response to axon injury; collagen biosynthetic process; response to amine stimulus; urea cycle; lung development

Disease: Argininemia