Lyve-1, soluble Recombinant Protein | Lyve1 recombinant protein

Mouse Lyve-1, soluble

Cat. Num. AAA692061

• Gene Names: Lyve1; Xlkd1; Lyve-1; Crsbp-1; 1200012G08Rik
• Purity: > 95% by SDS-PAGE & silver stain
• Synonyms: Lyve-1; soluble; Mouse Lyve-1; Recombinant Mouse Soluble LYVE-1-His; Lymphatic vessel endothelial hyaluronic acid receptor 1; Lyve1 recombinant protein

• Host: Insect Cells
• Purity/Purification: > 95% by SDS-PAGE & silver stain
• Form/Format: Lyophilized; PBS
• Sequence: ADLVQDLSISTCRIMGVALVGRNKNPQMNFTEANEACKMLGLTLASRDQVESAQKSGFETCSYGWVGEQFSVIPRIFSNPRCGKNGKGVLIWNAPSSQKFKAYCHNSSDTWVNSCIPEIVTTFYPVLTQTPATEFSVSSSAYLASSPDSTTPVSATTRAPPLTSMARKTKKICITEVYTEPITMATETEAFVASGAAFKNEAAGHHHHHH
• Sequence Length: 211

• N Terminal Sequence: ADLVQDLS
• Reconstitution: The lyophilized sLYVE-1 is soluble in water and most aqueous buffers. The lyophilized sLYVE-1 should be reconstituted in PBS or medium to a concentration not lower than 50ug/ml.
• Length (aa): 211
• Preparation and Storage: Store at -20°C to -70°C. Reconstituted sLYVE-1 should be stored in working aliquots at -20°C. Avoid repeated freeze-thaw cycles.

Testing Data

Related Product Information for Lyve1 recombinant protein

A DNA sequence encoding the extracellular domain of mouse LYVE-1 (Met1 - Gly228) was fused to a C-terminal His-tag (6xHis) and expressed in insect cells. Based on N-terminal sequence analysis, the primary structure of recombinant mature sLYVE-1 starts at Ala24. sLYVE-1 has a calculated monomeric molecular mass of about 25 kDa but as a result of glycosylation, migrates at approximately 35 - 45 kDa under reducing conditions in SDS-PAGE. LYVE-1 has been identified as a major receptor for HA (extracellular matrix glycosaminoglycan hyaluronan) on the lymph vessel wall. The deduced amino acid sequence of LYVE-1 predicts a 322-residue type I integral membrane polypeptide 41% similar to the CD44 HA receptor with a 212-residue extracellular domain containing a single Link module the prototypic HA binding domain of the Link protein superfamily. Like CD44, the LYVE-1 molecule binds both soluble and immobilized HA. However, unlike CD44, the LYVE-1 molecule colocalizes with HA on the luminal face of the lymph vessel wall and is completely absent from blood vessels. Hence, LYVE-1 is the first lymph-specific HA receptor to be characterized and is a uniquely powerful marker for lymph vessels themselves.

Product Categories/Family for Lyve1 recombinant protein

Soluble receptors

References

1. Carriera et al., Cancer Res 61:8079, 2001 2. Jackson DG Trends Cardiovasc Med 13:1, 2003 3. Sleeman et al., Microsc Res Tech 55:61, 2001 4. Mäkinen et al., EMBO J 20 : 4762, 2001

NCBI and Uniprot Product Information

• NCBI GI #: 31560771
• NCBI GeneID: 114332
• NCBI Accession #: NP_444477.2
• NCBI GenBank Nucleotide #: NM_053247.4
• UniProt Accession #: Q8BHC0; Q3TUC1; Q99NE4
• Molecular Weight: 35 - 45 kDa
• NCBI Official Full Name: lymphatic vessel endothelial hyaluronic acid receptor 1
• NCBI Official Synonym Full Names: lymphatic vessel endothelial hyaluronan receptor 1
• NCBI Official Symbol: Lyve1
• NCBI Official Synonym Symbols: Xlkd1; Lyve-1; Crsbp-1; 1200012G08Rik
• NCBI Protein Information: lymphatic vessel endothelial hyaluronic acid receptor 1; extra cellular link domain-containing 1; lymphatic vessel endothelial HA recptor-1; lymphatic vessel endothelial HA receptor-1; extracellular link domain-containing protein 1; cell surface retention sequence binding protein-1; cell surface retention sequence-binding protein 1
• UniProt Protein Name: Lymphatic vessel endothelial hyaluronic acid receptor 1
• Protein Family: Lymphatic vessel endothelial hyaluronic acid receptor
• UniProt Gene Name: Lyve1
• UniProt Synonym Gene Names: Crsbp1; Xlkd1; LYVE-1; CRSBP-1
• UniProt Entry Name: LYVE1_MOUSE

Uniprot Description

Function: Ligand-specific transporter trafficking between intracellular organelles (TGN) and the plasma membrane. Plays a role in autocrine regulation of cell growth mediated by growth regulators containing cell surface retention sequence binding (CRS). May act as a hyaluronan (HA) transporter, either mediating its uptake for catabolism within lymphatic endothelial cells themselves, or its transport into the lumen of afferent lymphatic vessels for subsequent re-uptake and degradation in lymph nodes. Ref.4

Subunit structure: Homodimer; disulfide-linked. Interacts with PDGFB and IGFBP3. Forms a transient ternary complex with PDGFB and PDGFRB in TGN. Ref.4

Subcellular location: Membrane; Single-pass type I membrane protein. Note: Localized to the plasma membrane and in vesicles near extranuclear membranes which may represent trans-Golgi network (TGN) and endosomes/prelysosomeal compartments. Undergoes ligand-dependent internalization and recycling at the cell surface. Ref.4

Post-translational modification: O-glycosylated

By similarity.

Sequence similarities: Contains 1 Link domain.