Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence analysis of A549 cells using TET3 antibody. Blue: DAPI for nuclear staining.)

Rabbit anti-Human TET3 Polyclonal Antibody | anti-TET3 antibody

TET3 Polyclonal Antibody

Gene Names
TET3; hCG_40738
Reactivity
Human
Applications
Immunofluorescence
Purity
Affinity Purification
Synonyms
TET3; Polyclonal Antibody; TET3 Polyclonal Antibody; hCG_40738; anti-TET3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
LWNPMKGEEGRIPAAGASQLDRAWQSFGLPLGSSEKLFGALKSEEKLWDPFSLEEGPAEEPPSKGAVKEEKGGGGAEEEEEELWSDSEHNFLDENIGGVAVAPAHGSILIECARRELHATTPLKKPNRCHPTRISLVFYQHKNLNQPNHGLALWEAKMKQLAERARARQEEAARLGLGQQEAKLYGKKRKWGGTVVAEPQQKEKKGVVPTRQALAVPTDSAVTVSSYAYTKVTGPYSRWI
Sequence Length
1795
Applicable Applications for anti-TET3 antibody
Immunofluorescence (IF)
Application Notes
IF: 1:50 - 1:200
Immunogen
Recombinant protein of human TET3
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cytoplasm, Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

Immunofluorescence (IF)

(Immunofluorescence analysis of A549 cells using TET3 antibody. Blue: DAPI for nuclear staining.)

Immunofluorescence (IF) (Immunofluorescence analysis of A549 cells using TET3 antibody. Blue: DAPI for nuclear staining.)
Product Categories/Family for anti-TET3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
77kDa/166kDa/179kDa
NCBI Official Full Name
methylcytosine dioxygenase TET3
NCBI Official Synonym Full Names
tet methylcytosine dioxygenase 3
NCBI Official Symbol
TET3
NCBI Official Synonym Symbols
hCG_40738
NCBI Protein Information
methylcytosine dioxygenase TET3
UniProt Protein Name
Methylcytosine dioxygenase TET3
Protein Family
UniProt Gene Name
TET3
UniProt Synonym Gene Names
KIAA0401

NCBI Description

Members of the ten-eleven translocation (TET) gene family, including TET3, play a role in the DNA methylation process (Langemeijer et al., 2009 [PubMed 19923888]).[supplied by OMIM, Nov 2010]

Uniprot Description

Dioxygenase that catalyzes the conversion of the modified genomic base 5-methylcytosine (5mC) into 5-hydroxymethylcytosine (5hmC) and plays a key role in epigenetic chromatin reprogramming in the zygote following fertilization. Also mediates subsequent conversion of 5hmC into 5-formylcytosine (5fC), and conversion of 5fC to 5-carboxylcytosine (5caC). Conversion of 5mC into 5hmC, 5fC and 5caC probably constitutes the first step in cytosine demethylation (). Selectively binds to the promoter region of target genes and contributes to regulate the expression of numerous developmental genes (PubMed:23217707). In zygotes, DNA demethylation occurs selectively in the paternal pronucleus before the first cell division, while the adjacent maternal pronucleus and certain paternally-imprinted loci are protected from this process. Participates in DNA demethylation in the paternal pronucleus by mediating conversion of 5mC into 5hmC, 5fC and 5caC. Does not mediate DNA demethylation of maternal pronucleus because of the presence of DPPA3/PGC7 on maternal chromatin that prevents TET3-binding to chromatin (). In addition to its role in DNA demethylation, also involved in the recruitment of the O-GlcNAc transferase OGT to CpG-rich transcription start sites of active genes, thereby promoting histone H2B GlcNAcylation by OGT (PubMed:23353889).

Research Articles on TET3

Similar Products

Product Notes

The TET3 tet3 (Catalog #AAA9133493) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TET3 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TET3 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF). IF: 1:50 - 1:200. Researchers should empirically determine the suitability of the TET3 tet3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LWNPMKGEEG RIPAAGASQL DRAWQSFGLP LGSSEKLFGA LKSEEKLWDP FSLEEGPAEE PPSKGAVKEE KGGGGAEEEE EELWSDSEHN FLDENIGGVA VAPAHGSILI ECARRELHAT TPLKKPNRCH PTRISLVFYQ HKNLNQPNHG LALWEAKMKQ LAERARARQE EAARLGLGQQ EAKLYGKKRK WGGTVVAEPQ QKEKKGVVPT RQALAVPTDS AVTVSSYAYT KVTGPYSRWI. It is sometimes possible for the material contained within the vial of "TET3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.