LYR motif-containing protein 7 (LYRM7) Recombinant Protein | LYRM7 recombinant protein

Recombinant Human LYR motif-containing protein 7 (LYRM7)

Cat. Num. AAA1316677

• Gene Names: LYRM7; MZM1L; MC3DN8; C5orf31
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: LYR motif-containing protein 7 (LYRM7); Recombinant Human LYR motif-containing protein 7 (LYRM7); LYRM7 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-104, Full length protein
• Sequence: MGRAVKVLQLFKTLHRTRQQVFKNDARALEAARIKINEEFKNNKSETSSKKIEELMKIGSDVELLLRTSVIQGIHTDHNTLKLVPRKDLLVENVPYCDAPTQKQ
• Sequence Length: 104

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 91176333
• NCBI GeneID: 90624
• NCBI Accession #: NP_859056.2
• NCBI GenBank Nucleotide #: NM_181705.3
• UniProt Accession #: Q5U5X0; Q86Y68; A8MPQ9
• Molecular Weight: 11,955 Da
• NCBI Official Full Name: complex III assembly factor LYRM7 isoform 1
• NCBI Official Synonym Full Names: LYR motif containing 7
• NCBI Official Symbol: LYRM7
• NCBI Official Synonym Symbols: MZM1L; MC3DN8; C5orf31
• NCBI Protein Information: complex III assembly factor LYRM7
• UniProt Protein Name: Complex III assembly factor LYRM7
• Protein Family: Complex III assembly factor
• UniProt Gene Name: LYRM7
• UniProt Synonym Gene Names: C5orf31; MZM1L

NCBI Description

Inner mitochondrial membrane complex III (CIII) is the main enzyme complex in the mitochondrial respiratory chain, and Rieske Fe-S protein (UQCRFS1) is the last catalytic subunit added to the complex. The protein encoded by this gene is a nuclear-encoded mitochondrial matrix protein that stabilizes UQCRFS1 and chaperones it to the CIII complex. Defects in this gene are a cause of mitochondrial complex III deficiency, nuclear type 8. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jun 2014]

Uniprot Description

Assembly factor required for Rieske Fe-S protein UQCRFS1 incorporation into the cytochrome b-c1 (CIII) complex. Functions as a chaperone, binding to this subunit within the mitochondrial matrix and stabilizing it prior to its translocation and insertion into the late CIII dimeric intermediate within the mitochondrial inner membrane.