Uncharacterized GPI-anchored protein At1g27950 (At1g27950) Recombinant Protein | At1g27950 recombinant protein
Recombinant Arabidopsis thaliana Uncharacterized GPI-anchored protein At1g27950 (At1g27950)
Gene Names
LTPG1; F13K9.6; F13K9_6; glycosylphosphatidylinositol-anchored lipid protein transfer 1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Uncharacterized GPI-anchored protein At1g27950 (At1g27950); Recombinant Arabidopsis thaliana Uncharacterized GPI-anchored protein At1g27950 (At1g27950); At1g27950 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
23-161, Full length protein
Sequence
APAAPGGALADECNQDFQKVTLCLDFATGKATIPSKKCCDAVEDIKERDPKCLCFVIQQAKTGGQALKDLGVQEDKLIQLPTSCQLHNASITNCPKLLGISPSSPDAAVFTNNATTTPVAPAGKSPATPATSTDKGGSA
Sequence Length
139
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
19,759 Da
NCBI Official Full Name
glycosylphosphatidylinositol-anchored lipid protein transfer 1
NCBI Official Symbol
LTPG1
NCBI Official Synonym Symbols
F13K9.6; F13K9_6; glycosylphosphatidylinositol-anchored lipid protein transfer 1
NCBI Protein Information
glycosylphosphatidylinositol-anchored lipid protein transfer 1
UniProt Protein Name
Non-specific lipid transfer protein GPI-anchored 1
UniProt Gene Name
LTPG1
UniProt Synonym Gene Names
AtLTPG-1; Protein LTP-GPI-ANCHORED 1
NCBI Description
Encodes LTPG1, a lipid transfer protein with a predicted GPI (glycosylphosphatidylinositol)-anchor domain. Localized in the plasma membrane. Disruption of the LTPG1 gene causes alterations of cuticular lipid composition, but no significant changes on total wax and cutin monomer loads are seen.
Uniprot Description
Lipid transfer protein that, together with LTPG2, binds to lipids and functions as a component of the cuticular lipid export machinery that performs extensive export of intracellular lipids (e.g. C29 alkane) from epidermal cells to the surface to build the cuticular wax layer and silique walls. Involved in the establishment of resistance to the necrotrophic fungal pathogen Alternaria brassicicola.
Research Articles on At1g27950
Similar Products
Product Notes
The At1g27950 ltpg1 (Catalog #AAA1368818) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-161, Full length protein. The amino acid sequence is listed below: APAAPGGALA DECNQDFQKV TLCLDFATGK ATIPSKKCCD AVEDIKERDP KCLCFVIQQA KTGGQALKDL GVQEDKLIQL PTSCQLHNAS ITNCPKLLGI SPSSPDAAVF TNNATTTPVA PAGKSPATPA TSTDKGGSA. It is sometimes possible for the material contained within the vial of "Uncharacterized GPI-anchored protein At1g27950 (At1g27950), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
