Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Leukotriene C4 synthase (Ltc4s) Recombinant Protein | Ltc4s recombinant protein

Recombinant Mouse Leukotriene C4 synthase (Ltc4s)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Leukotriene C4 synthase (Ltc4s); Recombinant Mouse Leukotriene C4 synthase (Ltc4s); Ltc4s recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-150aa; full length protein
Sequence
MKDEVALLATVTLVGVLLQAYFSLQVISARRAFHVSPPLTSGPPEFERVFRAQVNCSEYF PLFLATLWVAGIFFHEGAAALCGLFYLFARLRYFQGYARSAQLRLTPLYASARALWLLVA MAALGLLVHFLPGTLRTALFRWLQMLLPMA
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Ltc4s recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16,814 Da
NCBI Official Full Name
leukotriene C4 synthase isoform 1
NCBI Official Synonym Full Names
leukotriene C4 synthase
NCBI Official Symbol
Ltc4s
NCBI Protein Information
leukotriene C4 synthase
UniProt Protein Name
Leukotriene C4 synthase
Protein Family
UniProt Gene Name
Ltc4s
UniProt Synonym Gene Names
LTC4 synthase
UniProt Entry Name
LTC4S_MOUSE

NCBI Description

The protein encoded by this gene is an enzyme that catalyzes the synthesis of leukotriene C4 by combining leukotriene A4 with reduced glutathione. The encoded protein is found in the outer nuclear membrane and in the peripheral endoplasmic reticulum. Leukotrienes have been implicated as mediators of anaphylaxis and inflammatory conditions such as bronchial asthma in humans. Several transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Sep 2015]

Uniprot Description

LTC4S: Catalyzes the conjugation of leukotriene A4 with reduced glutathione to form leukotriene C4. Defects in LTC4S are the cause of leukotriene C4 synthase deficiency (LTC4 synthase deficiency). LTC4 synthase deficiency is a fatal neurometabolic developmental disorder. It is associated with muscular hypotonia, psychomotor retardation, failure to thrive, and microcephaly. Belongs to the MAPEG family.

Protein type: EC 4.4.1.20; Membrane protein, integral; Membrane protein, multi-pass; Endoplasmic reticulum; Nuclear envelope; Lipid Metabolism - arachidonic acid; Lyase

Cellular Component: endoplasmic reticulum; integral to membrane; intracellular membrane-bound organelle; membrane; nuclear envelope; nucleus

Molecular Function: enzyme activator activity; glutathione binding; glutathione peroxidase activity; glutathione transferase activity; leukotriene-C4 synthase activity; lipid binding; lyase activity; protein heterodimerization activity

Biological Process: leukotriene biosynthetic process; leukotriene metabolic process

Research Articles on Ltc4s

Similar Products

Product Notes

The Ltc4s ltc4s (Catalog #AAA7019623) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-150aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Ltc4s ltc4s for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MKDEVALLAT VTLVGVLLQA YFSLQVISAR RAFHVSPPLT SGPPEFERVF RAQVNCSEYF PLFLATLWVA GIFFHEGAAA LCGLFYLFAR LRYFQGYARS AQLRLTPLYA SARALWLLVA MAALGLLVHF LPGTLRTALF RWLQMLLPMA. It is sometimes possible for the material contained within the vial of "Leukotriene C4 synthase (Ltc4s), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.