Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Acyl-CoA:lysophosphatidylglycerol acyltransferase 1 (Lpgat1) Recombinant Protein | Lpgat1 recombinant protein

Recombinant Mouse Acyl-CoA:lysophosphatidylglycerol acyltransferase 1 (Lpgat1)

Gene Names
Lpgat1; AI649174; AW112037; BC013667
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Acyl-CoA:lysophosphatidylglycerol acyltransferase 1 (Lpgat1); Recombinant Mouse Acyl-CoA:lysophosphatidylglycerol acyltransferase 1 (Lpgat1); Lpgat1 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-370aa; full length protein
Sequence
MAVTVEEAPWLGWIVAKALMRFAFMVANNLVAIPSYICYVIILQPLRVLDSKRFWYIEGL MYKWLLGMVASWGWYAGYTVMEWGEDIKAIAKDEAVMLVNHQATGDVCTLMMCLQDKGPV VAQMMWLMDHIFKYTNFGIVSLIHGDFFIRQGRAYRDQQLLVLKKHLEHNYRSRDRKWIV LFPEGGFLRKRRETSQAFAKKNNLPFLTHVTLPRFGATNIILKALVARQENGSPAGGDAR GLECKSRGLQWIIDTTIAYPKAEPIDIQTWILGYRKPTVTHVHYRIFPIGDVPLETEDLT SWLYQRFIEKEDLLSHFYKTGAFPPPQGQKEAVCREMTLSNMWIFLIQSFAFLSGYLWYH IIQYFYHCLF
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Lpgat1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43,088 Da
NCBI Official Full Name
acyl-CoA:lysophosphatidylglycerol acyltransferase 1 isoform 2
NCBI Official Synonym Full Names
lysophosphatidylglycerol acyltransferase 1
NCBI Official Symbol
Lpgat1
NCBI Official Synonym Symbols
AI649174; AW112037; BC013667
NCBI Protein Information
acyl-CoA:lysophosphatidylglycerol acyltransferase 1
UniProt Protein Name
Acyl-CoA:lysophosphatidylglycerol acyltransferase 1
UniProt Gene Name
Lpgat1
UniProt Synonym Gene Names
Fam34a
UniProt Entry Name
LGAT1_MOUSE

Uniprot Description

LPGAT1: Lysophoshatidylglycerol (LPG) specific acyltransferase that recognizes various acyl-CoAs and LPGs as substrates but demonstrates a clear preference for long chain saturated fatty acyl-CoAs and oleoyl-CoA as acyl donors. Prefers oleoyl-LPG over palmitoyl-LPG as an acyl receptor and oleoyl-CoA over lauroyl-CoA as an acyl donor. Belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family.

Protein type: Membrane protein, multi-pass; EC 2.3.1.-; Transferase; Membrane protein, integral

Cellular Component: cytoplasm; endoplasmic reticulum; integral to membrane; membrane

Molecular Function: 3-hydroxybutyryl-CoA thiolase activity; 3-ketopimelyl-CoA thiolase activity; acetyltransferase activity; acyl-CoA N-acyltransferase activity; acylglycerol O-acyltransferase activity; azetidine-2-carboxylic acid acetyltransferase activity; benzoyl acetate-CoA thiolase activity; C-acyltransferase activity; C-palmitoyltransferase activity; carnitine O-acyltransferase activity; dihydrolipoamide branched chain acyltransferase activity; dihydrolipoamide S-acyltransferase activity; glucosaminyl-phosphotidylinositol O-acyltransferase activity; keto acid formate lyase activity; L-2-aminoadipate N-acetyltransferase activity; malonyltransferase activity; myristoyltransferase activity; N-acetyltransferase activity; N-acyltransferase activity; N-palmitoyltransferase activity; N-succinyltransferase activity; O-acetyltransferase activity; O-acyltransferase activity; O-octanoyltransferase activity; O-palmitoyltransferase activity; O-sinapoyltransferase activity; O-succinyltransferase activity; octanoyltransferase activity; palmitoleoyl [acyl-carrier-protein]-dependent acyltransferase activity; palmitoyltransferase activity; peptidyl-lysine N6-myristoyltransferase activity; peptidyl-lysine N6-palmitoyltransferase activity; protein-cysteine S-acyltransferase activity; protein-cysteine S-myristoyltransferase activity; Ras palmitoyltransferase activity; S-acetyltransferase activity; S-acyltransferase activity; S-malonyltransferase activity; S-succinyltransferase activity; serine O-acyltransferase activity; sinapoyltransferase activity; sterol O-acyltransferase activity; succinyltransferase activity; transferase activity; transferase activity, transferring acyl groups

Biological Process: lipid metabolic process; metabolic process; phospholipid biosynthetic process

Research Articles on Lpgat1

Similar Products

Product Notes

The Lpgat1 lpgat1 (Catalog #AAA7019047) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-370aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Lpgat1 lpgat1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAVTVEEAPW LGWIVAKALM RFAFMVANNL VAIPSYICYV IILQPLRVLD SKRFWYIEGL MYKWLLGMVA SWGWYAGYTV MEWGEDIKAI AKDEAVMLVN HQATGDVCTL MMCLQDKGPV VAQMMWLMDH IFKYTNFGIV SLIHGDFFIR QGRAYRDQQL LVLKKHLEHN YRSRDRKWIV LFPEGGFLRK RRETSQAFAK KNNLPFLTHV TLPRFGATNI ILKALVARQE NGSPAGGDAR GLECKSRGLQ WIIDTTIAYP KAEPIDIQTW ILGYRKPTVT HVHYRIFPIG DVPLETEDLT SWLYQRFIEK EDLLSHFYKT GAFPPPQGQK EAVCREMTLS NMWIFLIQSF AFLSGYLWYH IIQYFYHCLF. It is sometimes possible for the material contained within the vial of "Acyl-CoA:lysophosphatidylglycerol acyltransferase 1 (Lpgat1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.