Lysyl oxidase homolog 3 (LOXL3) Recombinant Protein | LOXL3 recombinant protein

Recombinant Human Lysyl oxidase homolog 3 (LOXL3), partial

Cat. Num. AAA9018509

• Gene Names: LOXL3; LOXL
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Lysyl oxidase homolog 3 (LOXL3); Recombinant Human Lysyl oxidase homolog 3 (LOXL3); partial; Lysyl oxidase-like protein 3; LOXL3 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 401-608aa, Partial
• Sequence: DRPLHMLYCAAEENCLASSARSANWPYGHRRLLRFSSQIHNLGRADFRPKAGRHSWVWHECHGHYHSMDIFTHYDILTPNGTKVAEGHKASFCLEDTECQEDVSKRYECANFGEQGITVGCWDLYRHDIDCQWIDITDVKPGNYILQVVINPNFEVAESDFTNNAMKCNCKYDGHRIWVHNCHIGDAFSEEANRRFERYPGQTSNQII

• Species: Homo sapiens (Human)
• Relevance: Protein-lysine 6-oxidase that mediates the oxidation of peptidyl lysine residues to allysine in target proteins (PubMed:17018530, PubMed:28065600). Catalyzes the post-translational oxidative deamination of peptidyl lysine residues in precursors of elastin and different types of collagens, a prerequisite in the formation of cross-links between collagens and elastin (PubMed:17018530). Required for somite boundary formation by catalyzing oxidation of fibronectin (FN1), enhancing integrin signaling in myofibers and their adhesion to the myotendinous junction (MTJ)(By similarity). Acts as a regulator of inflammatory response by inhibiting differentiation of naive CD4+ T-cells into T-helper Th17 or regulatory T-cells (Treg): acts by interacting with STAT3 in the nucleus and catalyzing both deacetylation and oxidation of lysine residues on STAT3, leading to disrupt STAT3 dimerization and inhibit STAT3 transcription activity (PubMed:28065600). Oxidation of lysine residues to allysine on STAT3 preferentially takes place on lysine residues that are acetylated (PubMed:28065600). Also able to catalyze deacetylation of lysine residues on STAT3 (PubMed:28065600).
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

Product Categories/Family for LOXL3 recombinant protein

Signal Transduction

References

"Lysyl oxidase 3 is a dual-specificity enzyme involved in STAT3 deacetylation and deacetylimination modulation."Ma L., Huang C., Wang X.J., Xin D.E., Wang L.S., Zou Q.C., Zhang Y.S., Tan M.D., Wang Y.M., Zhao T.C., Chatterjee D., Altura R.A., Wang C., Xu Y.S., Yang J.H., Fan Y.S., Han B.H., Si J. Chin Y.E.Mol. Cell 65:296-309(2017)

NCBI and Uniprot Product Information

• NCBI GI #: 574957232
• NCBI GeneID: 84695
• NCBI Accession #: NP_001276093.1
• NCBI GenBank Nucleotide #: NM_001289164.1
• UniProt Accession #: P58215; Q2EHP2; Q6IPL7; Q96RS1; D6W5J1
• Molecular Weight: 67,445 Da
• NCBI Official Full Name: lysyl oxidase homolog 3 isoform 2
• NCBI Official Synonym Full Names: lysyl oxidase like 3
• NCBI Official Symbol: LOXL3
• NCBI Official Synonym Symbols: LOXL
• NCBI Protein Information: lysyl oxidase homolog 3
• UniProt Protein Name: Lysyl oxidase homolog 3
• Protein Family: Lysyl oxidase
• UniProt Gene Name: LOXL3
• UniProt Synonym Gene Names: LOXL
• UniProt Entry Name: LOXL3_HUMAN

NCBI Description

This gene encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family. Alternatively spliced transcript variants of this gene have been reported but their full-length nature has not been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

LOXL3: a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family. Alternatively spliced transcript variants of this gene have been reported but their full-length nature has not been determined. [provided by RefSeq, Jul 2008]

Protein type: Oxidoreductase; EC 1.4.3.-; Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 2p13

Cellular Component: cytoplasm; extracellular region; extracellular space; membrane; nucleus

Molecular Function: copper ion binding; protein binding; protein-lysine 6-oxidase activity; scavenger receptor activity

Biological Process: epithelial to mesenchymal transition; negative regulation of transcription, DNA-dependent; receptor-mediated endocytosis