SDS-PAGE
Lon protease (lon), partial Recombinant Protein | lon recombinant protein
Recombinant Mycoplasma pneumoniae Lon protease (lon), partial
Gene Names
lon; F10_orf795
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Lon protease (lon); partial; Recombinant Mycoplasma pneumoniae Lon protease (lon); Lon protease; EC=3.4.21.53; ATP-dependent protease La; lon recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-206aa; Partial
Sequence
MPAVKKPQILVVRNQVIFPYNGFELDVGRERSKKLIKALKNLKTKRLVLVTQKNSDQLNPEFDDIYHCGTLCDIDEIIEVPSEDGKTADYKIKGKGLQRVAITSFSDADLTKYDHHFLNSTLTENKALDKLLERIFPDKEDFAEILDSLNSFLELQELKKLSKVPKDIKRYDIITFKLASLIFKDITLQQAILEENDIEKRLQKII
Species
Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-PAGE
SDS-PAGE
Related Product Information for lon recombinant protein
ATP-dependent serine protease that mediates the selective degradation of mutant and abnormal proteins as well as certain short-lived regulatory proteins. Required for cellular homeostasis and for survival from DNA damage and developmental changes induced by stress. Degrades polypeptides processively to yield small peptide fragments that are 5 to 10 amino acids long. Binds to DNA in a double-stranded, site-specific manner.
Product Categories/Family for lon recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39.8 kDa
NCBI Official Full Name
ATP-dependent protease Lon
NCBI Official Symbol
lon
NCBI Official Synonym Symbols
F10_orf795
NCBI Protein Information
ATP-dependent protease Lon
UniProt Protein Name
Lon protease
Protein Family
UniProt Gene Name
lon
UniProt Synonym Gene Names
MPN_332; MP504
UniProt Entry Name
LON_MYCPN
Uniprot Description
ATP-dependent serine protease that mediates the selective degradation of mutant and abnormal proteins as well as certain short-lived regulatory proteins. Required for cellular homeostasis and for survival from DNA damage and developmental changes induced by stress. Degrades polypeptides processively to yield small peptide fragments that are 5 to 10 amino acids long. Binds to DNA in a double-stranded, site-specific manner.
Similar Products
Product Notes
The lon lon (Catalog #AAA1141928) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-206aa; Partial. The amino acid sequence is listed below: MPAVKKPQIL VVRNQVIFPY NGFELDVGRE RSKKLIKALK NLKTKRLVLV TQKNSDQLNP EFDDIYHCGT LCDIDEIIEV PSEDGKTADY KIKGKGLQRV AITSFSDADL TKYDHHFLNS TLTENKALDK LLERIFPDKE DFAEILDSLN SFLELQELKK LSKVPKDIKR YDIITFKLAS LIFKDITLQQ AILEENDIEK RLQKII. It is sometimes possible for the material contained within the vial of "Lon protease (lon), partial, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
