Apolipoprotein N-acyltransferase (lnt) Recombinant Protein | HP0180 recombinant protein
Recombinant Helicobacter pylori Apolipoprotein N-acyltransferase (lnt)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Apolipoprotein N-acyltransferase (lnt); Recombinant Helicobacter pylori Apolipoprotein N-acyltransferase (lnt); Recombinant Apolipoprotein N-acyltransferase (lnt); Apolipoprotein N-acyltransferase; ALP N-acyltransferase EC= 2.3.1.-; HP0180 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-425
Sequence
MRLLLFNQNAFLLACMFVSSVYVNAVLDAYAIENPYISITLTSLLAPLSMLAFLKTPRNSAFALGFFVGALLFYWCALSFRYSDFTYLLPLIIVLIALVYGVLFYLLLYFENPYFRLLSFLGSSFIHPFGFDWLVPDSFFSYSVFRVDKLSLGLVFLACIFLSTKPLKKYRIIGVLLLLGALDFNGFKTSDLKKVGNIELVSTKTPQDLKFDSSYLNDIENNILKEIKLAQSKQKTLIVFPETAYPIALENSPFKAKLEDLSDNIAILIGTLRTQGYNLYNSSFLFSKESVQIADKVILAPFGETMPLPEFLQKPLEKLFFGESTYLYRNAPHFSDFTLDDFTFRPLICYEGTSKPAYSNSPSKIFIVMSNNAWFSPSIEPTLQRTLLKYYARRYDKIILHSANFSTSYILSPSLLGDILFRKRS
Sequence Length
425
Species
Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,474 Da
NCBI Official Full Name
apolipoprotein N-acyltransferase
NCBI Official Symbol
HP0180
NCBI Protein Information
apolipoprotein N-acyltransferase
UniProt Protein Name
Apolipoprotein N-acyltransferase
UniProt Gene Name
lnt
UniProt Synonym Gene Names
ALP N-acyltransferase
UniProt Entry Name
LNT_HELPY
Uniprot Description
Function: Transfers the fatty acyl group on membrane lipoproteins
By similarity. HAMAP-Rule MF_01148
Pathway: Protein modification; lipoprotein biosynthesis (N-acyl transfer). HAMAP-Rule MF_01148
Subcellular location: Cell inner membrane; Multi-pass membrane protein
By similarity HAMAP-Rule MF_01148.
Sequence similarities: Belongs to the CN hydrolase family. Apolipoprotein N-acyltransferase subfamily.
Similar Products
Product Notes
The HP0180 lnt (Catalog #AAA1144173) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-425. The amino acid sequence is listed below: MRLLLFNQNA FLLACMFVSS VYVNAVLDAY AIENPYISIT LTSLLAPLSM LAFLKTPRNS AFALGFFVGA LLFYWCALSF RYSDFTYLLP LIIVLIALVY GVLFYLLLYF ENPYFRLLSF LGSSFIHPFG FDWLVPDSFF SYSVFRVDKL SLGLVFLACI FLSTKPLKKY RIIGVLLLLG ALDFNGFKTS DLKKVGNIEL VSTKTPQDLK FDSSYLNDIE NNILKEIKLA QSKQKTLIVF PETAYPIALE NSPFKAKLED LSDNIAILIG TLRTQGYNLY NSSFLFSKES VQIADKVILA PFGETMPLPE FLQKPLEKLF FGESTYLYRN APHFSDFTLD DFTFRPLICY EGTSKPAYSN SPSKIFIVMS NNAWFSPSIE PTLQRTLLKY YARRYDKIIL HSANFSTSYI LSPSLLGDIL FRKRS. It is sometimes possible for the material contained within the vial of "Apolipoprotein N-acyltransferase (lnt), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
