Protein ERGIC-53 (LMAN1) Recombinant Protein | LMAN1 recombinant protein

Recombinant Human Protein ERGIC-53 (LMAN1), partial

Cat. Num. AAA960881

• Gene Names: LMAN1; MR60; gp58; F5F8D; FMFD1; MCFD1; ERGIC53; ERGIC-53
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Protein ERGIC-53 (LMAN1); Recombinant Human Protein ERGIC-53 (LMAN1); partial; LMAN1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 31-477aa; Partial-length
• Sequence: DGVGGDPAVALPHRRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIPSSDQIRVAPSLKSQRGSVWTKTKAAFENWEVEVTFRVTGRGRIGADGLAIWYAENQGLEGPVFGSADLWNGVGIFFDSFDNDGKKNNPAIVIIGNNGQIHYDHQNDGASQALASCQRDFRNKPYPVRAKITYYQNTLTVMINNGFTPDKNDYEFCAKVENMIIPAQGHFGISAATGGLADDHDVLSFLTFQLTEPGKEPPTPDKEISEKEKEKYQEEFEHFQQELDKKKEEFQKGHPDLQGQPAEEIFESVGDRELRQVFEGQNRIHLEIKQLNRQLDMILDEQRRYVSSLTEEISKRGAGMPGQHGQITQQELDTVVKTQHEILRQVNEMKNSMSETVRLVSGMQHPGSAGGVYETTQHFIDIKEHLHIVKRDIDNLVQRNMPSNEKPKCPELPPFPSCLS

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for LMAN1 recombinant protein

This protein is a type I integral membrane protein localized in the intermediate region between the endoplasmic reticulum and the Golgi, presumably recycling between the two compartments. The protein is a mannose-specific lectin and is a member of a novel family of plant lectin homologs in the secretory pathway of animal cells. Mutations in the gene are associated with a coagulation defect. Using positional cloning, the gene was identified as the disease gene leading to combined factor V-factor VIII deficiency, a rare, autosomal recessive disorder in which both coagulation factors V and VIII are diminished.

NCBI and Uniprot Product Information

• NCBI GI #: 5031873
• NCBI GeneID: 3998
• NCBI Accession #: NP_005561.1
• NCBI GenBank Nucleotide #: NM_005570.3
• UniProt Accession #: P49257; Q12895; Q8N5I7; Q9UQG1; Q9UQG2; Q9UQG3; Q9UQG4; Q9UQG5; Q9UQG6; Q9UQG7; Q9UQG8; Q9UQG9
• Molecular Weight: 57,549 Da
• NCBI Official Full Name: protein ERGIC-53
• NCBI Official Synonym Full Names: lectin, mannose binding 1
• NCBI Official Symbol: LMAN1
• NCBI Official Synonym Symbols: MR60; gp58; F5F8D; FMFD1; MCFD1; ERGIC53; ERGIC-53
• NCBI Protein Information: protein ERGIC-53
• UniProt Protein Name: Protein ERGIC-53
• Protein Family: Protein
• UniProt Gene Name: LMAN1
• UniProt Synonym Gene Names: ERGIC53; F5F8D

NCBI Description

The protein encoded by this gene is a membrane mannose-specific lectin that cycles between the endoplasmic reticulum, endoplasmic reticulum-Golgi intermediate compartment, and cis-Golgi, functioning as a cargo receptor for glycoprotein transport. The protein has an N-terminal signal sequence, a calcium-dependent and pH-sensitive carbohydrate recognition domain, a stalk region that functions in oligomerization, a transmembrane domain, and a short cytoplasmic domain required for organelle targeting. Allelic variants of this gene are associated with the autosomal recessive disorder combined factor V-factor VIII deficiency. [provided by RefSeq, Jul 2015]

Uniprot Description

Mannose-specific lectin. May recognize sugar residues of glycoproteins, glycolipids, or glycosylphosphatidyl inositol anchors and may be involved in the sorting or recycling of proteins, lipids, or both. The LMAN1-MCFD2 complex forms a specific cargo receptor for the ER-to-Golgi transport of selected proteins.