Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog (LITAF) Recombinant Protein | LITAF recombinant protein

Recombinant Chicken Lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog (LITAF)

Gene Names
LITAF; TNF-alpha
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog (LITAF); Recombinant Chicken Lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog (LITAF); LITAF recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-148, Full length protein
Sequence
MSAPSGFPAPSAPPSYEETVGINVNYPHPYPVPQPGLRPDGKGMNPPQYSGQPMPTSTPVTVQTVYVQQPVVLFYDRPVQMSCPSCNQMIVTRLCYESGALTWLSCGGLFLLGCIAGCCLIPFCVDALKDVEHFCPNCNAHVGSYKRL
Sequence Length
148
Species
Chicken
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for LITAF recombinant protein
Lipopolysaccharide is a potent stimulator of monocytes and macrophages, causing secretion of tumor necrosis factor-alpha (TNF-alpha) and other inflammatory mediators. This gene encodes lipopolysaccharide-induced TNF-alpha factor, which is a DNA-binding protein and can mediate the TNF-alpha expression by direct binding to the promoter region of the TNF-alpha gene. The transcription of this gene is induced by tumor suppresor p53 and has been implicated in the p53-induced apoptotic pathway. Mutations in this gene cause Charcot-Marie-Tooth disease type 1C (CMT1C) and may be involved in the carcinogenesis of extramammary Paget s disease (EMPD). Multiple alternatively spliced transcript variants have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16,013 Da
NCBI Official Full Name
lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog
NCBI Official Synonym Full Names
lipopolysaccharide induced TNF factor
NCBI Official Symbol
LITAF
NCBI Official Synonym Symbols
TNF-alpha
NCBI Protein Information
lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog
UniProt Protein Name
Lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog
UniProt Gene Name
LITAF
UniProt Synonym Gene Names
SIMPLE; LPS-induced TNF-alpha factor homolog

Uniprot Description

Plays a role in endosomal protein trafficking and in targeting proteins for lysosomal degradation. May also contribute to the regulation of gene expression in the nucleus. Binds DNA (in vitro) and may play a synergistic role in the nucleus in regulating the expression of numerous cytokines.

Research Articles on LITAF

Similar Products

Product Notes

The LITAF litaf (Catalog #AAA1390699) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-148, Full length protein. The amino acid sequence is listed below: MSAPSGFPAP SAPPSYEETV GINVNYPHPY PVPQPGLRPD GKGMNPPQYS GQPMPTSTPV TVQTVYVQQP VVLFYDRPVQ MSCPSCNQMI VTRLCYESGA LTWLSCGGLF LLGCIAGCCL IPFCVDALKD VEHFCPNCNA HVGSYKRL. It is sometimes possible for the material contained within the vial of "Lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog (LITAF), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.