Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Putative uncharacterized protein encoded by LINC00116 (LINC00116) Recombinant Protein | LINC00116 recombinant protein

Recombinant Human Putative uncharacterized protein encoded by LINC00116 (LINC00116)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Putative uncharacterized protein encoded by LINC00116 (LINC00116); Recombinant Human Putative uncharacterized protein encoded by LINC00116 (LINC00116); LINC00116 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-138aa; full length protein
Sequence
MLANDVRHQQEMWGFRKVEGGVVQSLGKSSVEGETDGTISEFREIQRLAAFASFLSHAPP LNARRLLTPPPRRRPRCTPAAAMADVSERTLQLSVLVAFASGVLLGWQANRLRRRYLDWR KRRLQDKLAATQKKLDLA
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for LINC00116 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
6,527 Da
NCBI Official Full Name
Uncharacterized protein encoded by LINC00116
UniProt Protein Name
Uncharacterized protein encoded by LINC00116
UniProt Gene Name
LINC00116
UniProt Synonym Gene Names
NCRNA00116
UniProt Entry Name
YB039_HUMAN

Uniprot Description

LINC00116: 2 isoforms of the human protein are produced by alternative initiation

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 2q13

Cellular Component: integral to membrane

Similar Products

Product Notes

The LINC00116 linc00116 (Catalog #AAA7018904) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-138aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the LINC00116 linc00116 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MLANDVRHQQ EMWGFRKVEG GVVQSLGKSS VEGETDGTIS EFREIQRLAA FASFLSHAPP LNARRLLTPP PRRRPRCTPA AAMADVSERT LQLSVLVAFA SGVLLGWQAN RLRRRYLDWR KRRLQDKLAA TQKKLDLA. It is sometimes possible for the material contained within the vial of "Putative uncharacterized protein encoded by LINC00116 (LINC00116), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.