Protein lin-28 homolog B (Lin28b) Recombinant Protein | Lin28b recombinant protein

Recombinant Mouse Protein lin-28 homolog B (Lin28b)

Cat. Num. AAA1354077

• Gene Names: Lin28b; Lin-28.2; 2810403D23Rik; D030047M17Rik
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Protein lin-28 homolog B (Lin28b); Recombinant Mouse Protein lin-28 homolog B (Lin28b); Lin28b recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-247, full length protein
• Sequence: MAEGGASKGEEPEKLPGLAEDEPQVLHGTGHCKWFNVRMGFGFISMISREGNPLDIPVDVFVHQSKLFMEGFRSLKEGEPVEFTFKKSPKGLESIRVTGPGGSPCLGSERRPKGKTLQKRKPKGDRCYNCGGLDHHAKECSLPPQPKKCHYCQSIMHMVANCPHKLAAQLPASSQGRQEAESQPCSSAAPREVGGGHGCTVLFPQEVKSEMAEHSDRSPQEVSSTKAFAAIGEQNKKGPLIQKRKKT
• Sequence Length: 247

• Species: Mouse
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 78042603
• NCBI GeneID: 380669
• NCBI Accession #: NP_001026942.1
• NCBI GenBank Nucleotide #: NM_001031772.2
• UniProt Accession #: Q45KJ6; Q3UZC6; Q3V444
• Molecular Weight: 10,571 Da
• NCBI Official Full Name: protein lin-28 homolog B
• NCBI Official Synonym Full Names: lin-28 homolog B (C. elegans)
• NCBI Official Symbol: Lin28b
• NCBI Official Synonym Symbols: Lin-28.2; 2810403D23Rik; D030047M17Rik
• NCBI Protein Information: protein lin-28 homolog B
• UniProt Protein Name: Protein lin-28 homolog B
• Protein Family: Protein
• UniProt Gene Name: Lin28b
• UniProt Synonym Gene Names: Lin-28B

Uniprot Description

Suppressor of microRNA (miRNA) biogenesis, including that of let-7 and possibly of miR107, miR-143 and miR-200c. Binds primary let-7 transcripts (pri-let-7), including pri-let-7g and pri-let-7a-1, and sequester them in the nucleolus, away from the microprocessor complex, hence preventing their processing into mature miRNA. Does not act on pri-miR21. The repression of let-7 expression is required for normal development and contributes to maintain the pluripotent state of embryonic stem cells by preventing let-7-mediated differentiation. When overexpressed, recruits ZCCHC11/TUT4 uridylyltransferase to pre-let-7 transcripts, leading to their terminal uridylation and degradation. This activity might not be relevant in vivo, as LIN28B-mediated inhibition of let-7 miRNA maturation appears to be ZCCHC11-independent. Interaction with target pre-miRNAs occurs via an 5'-GGAG-3' motif in the pre-miRNA terminal loop (). Mediates MYC-induced let-7 repression (PubMed:19211792). When overexpressed, may stimulate growth of carcinoma cell lines ().