lin-28 homolog A (LIN28A) Recombinant Protein | LIN28A recombinant protein

Recombinant Human Protein lin-28 homolog A (LIN28A), partial

Cat. Num. AAA9018656

• Gene Names: LIN28A; CSDD1; LIN28; LIN-28; ZCCHC1; lin-28A
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: lin-28 homolog A (LIN28A); Recombinant Human Protein lin-28 homolog A (LIN28A); partial; Zinc finger CCHC domain-containing protein 1; LIN28A recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 39-112aa, Partial
• Sequence: HGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGP

• Species: Homo sapiens (Human)
• Relevance: RNA-binding protein that inhibits processing of pre-let-7 miRNAs and regulates translation of mRNAs that control developmental timing, pluripotency and metabolism (PubMed:21247876). Seems to recognize a common structural G-quartet (G4) feature in its miRNA and mRNA targets (Probable). 'Translational enhancer' that drives specific mRNAs to polysomes and increases the efficiency of protein synthesis. Its association with the translational machinery and target mRNAs results in an increased number of initiation events per molecule of mRNA and, indirectly, in mRNA stabilization. Binds IGF2 mRNA, MYOD1 mRNA, ARBP/36B4 ribosomal protein mRNA and its own mRNA. Essential for skeletal muscle differentiation program through the translational up-regulation of IGF2 expression. Suppressor of microRNA (miRNA) biogenesis, including that of let-7, miR107, miR-143 and miR-200c. Specifically binds the miRNA precursors (pre-miRNAs), recognizing an 5'-GGAG-3' motif found in pre-miRNA terminal loop, and recruits TUT4 AND tut7 uridylyltransferaseS. This results in the terminal uridylation of target pre-miRNAs. Uridylated pre-miRNAs fail to be processed by Dicer and undergo degradation. The repression of let-7 expression is required for normal development and contributes to maintain the pluripotent state by preventing let-7-mediated differentiation of embryonic stem cells (PubMed:18951094, PubMed:19703396, PubMed:22118463, PubMed:22898984). Localized to the periendoplasmic reticulum area, binds to a large number of spliced mRNAs and inhibits the translation of mRNAs destined for the ER, reducing the synthesis of transmembrane proteins, ER or Golgi lumen proteins, and secretory proteins. Binds to and enhances the translation of mRNAs for several metabolic enzymes, such as PFKP, PDHA1 or SDHA, increasing glycolysis and oxidative phosphorylation. Which, with the let-7 repression may enhance tissue repair in adult tissue (By similarity).
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

Product Categories/Family for LIN28A recombinant protein

Others

References

"Lin28-mediated control of let-7 microRNA expression by alternative TUTases Zcchc11 (TUT4) and Zcchc6 (TUT7)."Thornton J.E., Chang H.M., Piskounova E., Gregory R.I.RNA 18:1875-1885(2012)

NCBI and Uniprot Product Information

• NCBI GI #: 13375938
• NCBI GeneID: 79727
• NCBI Accession #: NP_078950.1
• NCBI GenBank Nucleotide #: NM_024674.4
• UniProt Accession #: Q9H9Z2
• Molecular Weight: 22,743 Da
• NCBI Official Full Name: protein lin-28 homolog A
• NCBI Official Synonym Full Names: lin-28 homolog A (C. elegans)
• NCBI Official Symbol: LIN28A
• NCBI Official Synonym Symbols: CSDD1; LIN28; LIN-28; ZCCHC1; lin-28A
• NCBI Protein Information: protein lin-28 homolog A; RNA-binding protein LIN-28; zinc finger CCHC domain-containing protein 1; zinc finger, CCHC domain containing 1
• UniProt Protein Name: Protein lin-28 homolog A
• Protein Family: Protein
• UniProt Gene Name: LIN28A
• UniProt Synonym Gene Names: CSDD1; LIN28; ZCCHC1; Lin-28A
• UniProt Entry Name: LN28A_HUMAN

Uniprot Description

LIN28A: Acts as a 'translational enhancer', driving specific mRNAs to polysomes and thus increasing the efficiency of protein synthesis. Its association with the translational machinery and target mRNAs results in an increased number of initiation events per molecule of mRNA and, indirectly, in stabilizing the mRNAs. Binds IGF2 mRNA, MYOD1 mRNA, ARBP/36B4 ribosomal protein mRNA and its own mRNA. Essential for skeletal muscle differentiation program through the translational up-regulation of IGF2 expression. Acts as a suppressor of microRNA (miRNA) biogenesis by specifically binding the precursor let-7 (pre-let- 7), a miRNA precursor. Acts by binding pre-let-7 and recruiting ZCCHC11/TUT4 uridylyltransferase, leading to the terminal uridylation of pre-let-7. Uridylated pre-let-7 miRNAs fail to be processed by Dicer and undergo degradation. Degradation of pre- let-7 in embryonic stem (ES) cells contributes to the maintenance of ES cells. In contrast, LIN28A down-regulation in neural stem cells by miR-125, allows the processing of pre-let-7. Specifically recognizes the 5'-GGAG-3' motif in the terminal loop of pre-let-7. Also recognizes and binds non pre-let-7 pre-miRNAs that contain the 5'-GGAG-3' motif in the terminal loop, leading to their terminal uridylation and subsequent degradation. Monomer. During skeletal muscle differentiation, associated with translation initiation complexes in the polysomal compartment. Directly interacts with EIF3S2. Interaction with NCL is RNA-dependent. Interacts with ZCCHC11/TUT4. Can be negatively regulated by the interaction of microRNAs miR-125a and miR-125b with at least two miRNA responsive elements (miREs) in the 3'-UTR of this gene. These interactions may reduce both translation efficiency and mRNA abundance. Negatively regulated by retinoic acid. Expressed in embryonic stem cells (ES cells), placenta and testis. Belongs to the lin-28 family.

Protein type: Translation; RNA-binding; Nucleolus

Chromosomal Location of Human Ortholog: 1p36.11

Cellular Component: stress granule; cytoplasm; nucleolus; nucleus; cytosol

Molecular Function: mRNA binding; protein binding; miRNA binding; DNA binding; zinc ion binding; RNA binding; translation initiation factor binding

Biological Process: positive regulation of translation; regulation of transcription, DNA-dependent; pre-microRNA processing; somatic stem cell maintenance; stem cell maintenance; positive regulation of neuron differentiation; RNA 3'-end processing; germ cell development; negative regulation of glial cell differentiation