Lens fiber membrane intrinsic protein (Lim2) Recombinant Protein | Lim2 recombinant protein
Recombinant Rat Lens fiber membrane intrinsic protein (Lim2)
Gene Names
Lim2; MP20; Mp19
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Lens fiber membrane intrinsic protein (Lim2); Recombinant Rat Lens fiber membrane intrinsic protein (Lim2); Recombinant Lens fiber membrane intrinsic protein (Lim2); Lens fiber membrane intrinsic protein; MP17 MP18 MP19 MP20; Lim2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-173
Sequence
MYSFMGGGLFCAWVGTILLVVATATDHWMQYRLSGSFAHQGLWRYCLGNKCFLQTESIAYWNATRAFMILSALCATSGIIMGVLAFAQQSTFTRLSRPFSAGIMFFASTLFVLLALAIYTGVTVSFLGRRFGDWRFSWSYILGWVALLMTFFAGIFYMCAYRMHECRRLSTPR
Sequence Length
173
Species
Rattus norvegicus (Rat)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19,637 Da
NCBI Official Full Name
lens fiber membrane intrinsic protein
NCBI Official Synonym Full Names
lens intrinsic membrane protein 2
NCBI Official Symbol
Lim2
NCBI Official Synonym Symbols
MP20; Mp19
NCBI Protein Information
lens fiber membrane intrinsic protein; MP17; MP18; lens intrinsic membrane protein 2, 19kDa
UniProt Protein Name
Lens fiber membrane intrinsic protein
Protein Family
UniProt Gene Name
Lim2
UniProt Entry Name
LMIP_RAT
NCBI Description
lens fiber-cell intrinsic membrane protein; ligand of galectin-3 [RGD, Feb 2006]
Uniprot Description
Function: Present in the thicker 16-17 nm junctions of mammalian lens fiber cells, where it may contribute to cell junctional organization. Acts as a receptor for calmodulin. May play an important role in both lens development and cataractogenesis.
Subunit structure: Seems to be associated with itself or another lens membrane component via disulfide bonds.
Subcellular location: Membrane; Multi-pass membrane protein.
Tissue specificity: Eye lens specific.
Sequence similarities: Belongs to the PMP-22/EMP/MP20 family.
Research Articles on Lim2
Similar Products
Product Notes
The Lim2 lim2 (Catalog #AAA964685) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-173. The amino acid sequence is listed below: MYSFMGGGLF CAWVGTILLV VATATDHWMQ YRLSGSFAHQ GLWRYCLGNK CFLQTESIAY WNATRAFMIL SALCATSGII MGVLAFAQQS TFTRLSRPFS AGIMFFASTL FVLLALAIYT GVTVSFLGRR FGDWRFSWSY ILGWVALLMT FFAGIFYMCA YRMHECRRLS TPR. It is sometimes possible for the material contained within the vial of "Lens fiber membrane intrinsic protein (Lim2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
