Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Lutropin-choriogonadotropic hormone receptor Recombinant Protein | Lhcgr recombinant protein

Recombinant Rat Lutropin-choriogonadotropic hormone receptor

Gene Names
Lhcgr; Lhr; LSHR; LSH-R; LH/CG-R
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Lutropin-choriogonadotropic hormone receptor; Recombinant Rat Lutropin-choriogonadotropic hormone receptor; Luteinizing hormone receptor; LSH-R; Lhcgr recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
27-362aa; Extracellular Domain
Sequence
RELSGSRCPEPCDCAPDGALRCPGPRAGLARLSLTYLPVKVIPSQAFRGLNEVVKIEISQSDSLERIEANAFDNLLNLSELLIQNTKNLLYIEPGAFTNLPRLKYLSICNTGIRTLPDVTKISSSEFNFILEICDNLHITTIPGNAFQGMNNESVTLKLYGNGFEEVQSHAFNGTTLISLELKENIYLEKMHSGAFQGATGPSILDISSTKLQALPSHGLESIQTLIALSSYSLKTLPSKEKFTSLLVATLTYPSHCCAFRNLPKKEQNFSFSIFENFSKQCESTVRKADNETLYSAIFEENELSGWDYDYGFCSPKTLQCAPEPDAFNPCEDIMG
Sequence Length
700
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for Lhcgr recombinant protein
Receptor for lutropin-choriogonadotropic hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase.
References
Lutropin-choriogonadotropin receptor an unusual member of the G protein-coupled receptor family.McFarland K.C., Sprengel R., Phillips H.S., Koehler M., Rosemblit N., Nikolics K., Segaloff D.L., Seeburg P.H.Science 245:494-499(1989) Expression of the LH/CG receptor gene in rat ovarian tissue is regulated by an extensive alternative splicing of the primary transcript.Aatsinki J.T., Pietila E.M., Lakkakorpi J.T., Rajaniemi H.J.Mol. Cell. Endocrinol. 84:127-135(1992) Structure of the luteinizing hormone receptor gene and multiple exons of the coding sequence.Koo Y.B., Slaughter R.G., Ji T.H.Endocrinology 128:2297-2308(1991) Cloning of rat lutropin (LH) receptor analogs lacking the soybean lectin domain.Bernard M.P., Myers R.V., Moyle W.R.Mol. Cell. Endocrinol. 71:R19-R23(1990) Structure of the lutropin/choriogonadotropin receptor.Segaloff D.L., Sprengel R., Nikolics K., Ascoli M.Recent Prog. Horm. Res. 46:261-301(1990) Structural organization of the rat luteinizing hormone (LH) receptor gene.Tsai-Morris C.H., Buczko E., Wang W., Xie X.-Z., Dufau M.L.J. Biol. Chem. 266:11355-11359(1991) Intronic nature of the rat luteinizing hormone receptor gene defines a soluble receptor subspecies with hormone binding activity.Tsai-Morris C.H., Buczko E., Wang W., Dufau M.L.J. Biol. Chem. 265:19385-19388(1990) Characterization and structure of ovarian and testicular LH/hCG receptors.Dufau M.L., Minegishi T., Buczko E.S., Delgado C.J., Zhang R.J. Steroid Biochem. 33:715-720(1989) Purification, characterization, and amino-terminal sequence of rat ovarian receptor for luteinizing hormone/human choriogonadotropin.Roche P.C., Ryan R.J.J. Biol. Chem. 264:4636-4641(1989) Asp383 in the second transmembrane domain of the lutropin receptor is important for high affinity hormone binding and cAMP production.Ji I., Ji T.H.J. Biol. Chem. 266:14953-14957(1991) The lutropin/choriogonadotropin receptor is palmitoylated at intracellular cysteine residues.Zhu H., Wang H., Ascoli M.Mol. Endocrinol. 9:141-150(1995)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39.2 kDa
NCBI Official Full Name
lutropin-choriogonadotropic hormone receptor
NCBI Official Synonym Full Names
luteinizing hormone/choriogonadotropin receptor
NCBI Official Symbol
Lhcgr
NCBI Official Synonym Symbols
Lhr; LSHR; LSH-R; LH/CG-R
NCBI Protein Information
lutropin-choriogonadotropic hormone receptor
UniProt Protein Name
Lutropin-choriogonadotropic hormone receptor
UniProt Gene Name
Lhcgr
UniProt Synonym Gene Names
LH/CG-R; LSH-R
UniProt Entry Name
LSHR_RAT

NCBI Description

for both luteinizing hormone and choriogonadotropin; involved in reproductive development and function [RGD, Feb 2006]

Uniprot Description

LHR: Receptor for lutropin-choriogonadotropic hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. Defects in LHCGR are a cause of familial male precocious puberty (FMPP); also known as testotoxicosis. In FMPP the receptor is constitutively activated. Defects in LHCGR are the cause of luteinizing hormone resistance (LHR); also known as Leydig cell hypoplasia in males. LHR is an autosomal recessive disorder characterized by unresponsiveness to luteinizing hormone, defective sexual development in males, and defective follicular development and ovulation, amenorrhea and infertility in females. Two forms of the disorder have been defined in males. Type 1 is a severe form characterized by complete 46,XY male pseudohermaphroditism, low testosterone and high luteinizing hormone levels, total lack of responsiveness to luteinizing and chorionic gonadotropin hormones, lack of breast development, and absent development of secondary male sex characteristics. Type 2, a milder form, displays a broader range of phenotypic expression ranging from micropenis to severe hypospadias. Belongs to the G-protein coupled receptor 1 family. FSH/LSH/TSH subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Membrane protein, integral; Receptor, GPCR; GPCR, family 1

Cellular Component: cytoplasm; endoplasmic reticulum; endosome; extracellular space; integral to plasma membrane; lysosome; nucleus; plasma membrane; receptor complex

Molecular Function: ATPase binding; identical protein binding; lutropin-choriogonadotropic hormone receptor activity; peptide hormone binding; peptide receptor activity, G-protein coupled; protein homodimerization activity

Biological Process: adenylate cyclase activation; arachidonic acid secretion; central nervous system development; cognition; development of secondary male sexual characteristics; female gonad development; G-protein signaling, adenylate cyclase activating pathway; G-protein signaling, coupled to cAMP nucleotide second messenger; G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); hormone-mediated signaling; luteinizing hormone signaling pathway; male gonad development; ovarian follicle development; ovulation cycle process; positive regulation of calcium-mediated signaling; positive regulation of hormone biosynthetic process; positive regulation of inositol trisphosphate biosynthetic process; positive regulation of release of sequestered calcium ion into cytosol; protein targeting to lysosome; regulation of steroid biosynthetic process; response to drug; spermatogenesis; uterus development

Research Articles on Lhcgr

Similar Products

Product Notes

The Lhcgr lhcgr (Catalog #AAA965638) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 27-362aa; Extracellular Domain. The amino acid sequence is listed below: RELSGSRCPE PCDCAPDGAL RCPGPRAGLA RLSLTYLPVK VIPSQAFRGL NEVVKIEISQ SDSLERIEAN AFDNLLNLSE LLIQNTKNLL YIEPGAFTNL PRLKYLSICN TGIRTLPDVT KISSSEFNFI LEICDNLHIT TIPGNAFQGM NNESVTLKLY GNGFEEVQSH AFNGTTLISL ELKENIYLEK MHSGAFQGAT GPSILDISST KLQALPSHGL ESIQTLIALS SYSLKTLPSK EKFTSLLVAT LTYPSHCCAF RNLPKKEQNF SFSIFENFSK QCESTVRKAD NETLYSAIFE ENELSGWDYD YGFCSPKTLQ CAPEPDAFNP CEDIMG. It is sometimes possible for the material contained within the vial of "Lutropin-choriogonadotropic hormone receptor, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.