Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Lutropin subunit beta (Lhb) Recombinant Protein | Lhb recombinant protein

Recombinant Rat Lutropin subunit beta (Lhb)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Lutropin subunit beta (Lhb); Recombinant Rat Lutropin subunit beta (Lhb); Lhb recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
21-141, full length protein
Sequence
SRGPLRPLCRPVNATLAAENEFCPVCITFTTSICAGYCPSMVRVLPAALPPVPQPVCTYRELRFASVRLPGCPPGVDPIVSFPVALSCRCGPCRLSSSDCGGPRTQPMTCDLPHLPGLLLF
Sequence Length
121
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Lhb recombinant protein
This gene is a member of the glycoprotein hormone beta chain family and encodes the beta subunit of luteinizing hormone (LH). Glycoprotein hormones are heterodimers consisting of a common alpha subunit and an unique beta subunit which confers biological specificity. LH is expressed in the pituitary gland and promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids. The genes for the beta chains of chorionic gonadotropin and for luteinizing hormone are contiguous on chromosome 19q13.3. Mutations in this gene are associated with hypogonadism which is characterized by infertility and pseudohermaphroditism.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15,177 Da
NCBI Official Full Name
lutropin subunit beta isoform 2
NCBI Official Synonym Full Names
luteinizing hormone beta polypeptide
NCBI Official Symbol
Lhb
NCBI Protein Information
lutropin subunit beta
UniProt Protein Name
Lutropin subunit beta
UniProt Gene Name
Lhb
UniProt Synonym Gene Names
Lutropin beta chain; LH-B; LSH-B; LSH-beta

NCBI Description

subunit of luteinizing hormone; involved in spermatogenesis and oogenesis [RGD, Feb 2006]

Uniprot Description

Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids.

Research Articles on Lhb

Similar Products

Product Notes

The Lhb lhb (Catalog #AAA1233368) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 21-141, full length protein. The amino acid sequence is listed below: SRGPLRPLCR PVNATLAAEN EFCPVCITFT TSICAGYCPS MVRVLPAALP PVPQPVCTYR ELRFASVRLP GCPPGVDPIV SFPVALSCRC GPCRLSSSDC GGPRTQPMTC DLPHLPGLLL F. It is sometimes possible for the material contained within the vial of "Lutropin subunit beta (Lhb), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.