Prolipoprotein diacylglyceryl transferase (lgt) Recombinant Protein | lgt recombinant protein
Recombinant Borrelia burgdorferi Prolipoprotein diacylglyceryl transferase (lgt)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Prolipoprotein diacylglyceryl transferase (lgt); Recombinant Borrelia burgdorferi Prolipoprotein diacylglyceryl transferase (lgt); Recombinant Prolipoprotein diacylglyceryl transferase (lgt); Prolipoprotein diacylglyceryl transferase EC= 2.4.99.-; lgt recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-328
Sequence
MPNYINYPSWLHPEVIQGIPITWYSLSYILIILISYKFIWYQIQSDNVDIKKEDYEIFMFSLVLGAILGGRLASTLVYDKSGIYYSNPWLILLPFDQHWNFTGFRGMAIHGGFLGAIIAPLITINTKLKNTNVQKYFLKLTDYGSIAFSSGYILGRLANFANAELYGRVMKGGIIFPNAEPFDTNIPGVKEFASSVGLEISPHDLLINLPRIPSQLIEGFFEGPVTFLLLWFLFKKIKKYDGFIFGVYVMLYAFFRFFIEYLREPDKELGFIITYKPITSLSEFSFLNISMGQILSLTLMLSGLIWIIVTKKIADKKIKNNTNLAYKN
Sequence Length
328
Species
Borrelia burgdorferi (strain ZS7)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37,609 Da
NCBI Official Full Name
prolipoprotein diacylglyceryl transferase
NCBI Official Symbol
lgt
NCBI Protein Information
prolipoprotein diacylglyceryl transferase
UniProt Protein Name
Prolipoprotein diacylglyceryl transferase
Protein Family
UniProt Gene Name
lgt
UniProt Entry Name
LGT_BORBZ
Uniprot Description
Function: Transfers the N-acyl diglyceride group on what will become the N-terminal cysteine of membrane lipoproteins
By similarity. HAMAP-Rule MF_01147
Pathway: Protein modification; lipoprotein biosynthesis (diacylglyceryl transfer). HAMAP-Rule MF_01147
Subcellular location: Cell inner membrane; Multi-pass membrane protein
By similarity HAMAP-Rule MF_01147.
Sequence similarities: Belongs to the lgt family.
Similar Products
Product Notes
The lgt lgt (Catalog #AAA1018828) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-328. The amino acid sequence is listed below: MPNYINYPSW LHPEVIQGIP ITWYSLSYIL IILISYKFIW YQIQSDNVDI KKEDYEIFMF SLVLGAILGG RLASTLVYDK SGIYYSNPWL ILLPFDQHWN FTGFRGMAIH GGFLGAIIAP LITINTKLKN TNVQKYFLKL TDYGSIAFSS GYILGRLANF ANAELYGRVM KGGIIFPNAE PFDTNIPGVK EFASSVGLEI SPHDLLINLP RIPSQLIEGF FEGPVTFLLL WFLFKKIKKY DGFIFGVYVM LYAFFRFFIE YLREPDKELG FIITYKPITS LSEFSFLNIS MGQILSLTLM LSGLIWIIVT KKIADKKIKN NTNLAYKN. It is sometimes possible for the material contained within the vial of "Prolipoprotein diacylglyceryl transferase (lgt), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
