SDS-PAGE
Signal peptidase I Recombinant Protein | lepB recombinant protein
Recombinant Mycobacterium tuberculosis Signal peptidase I
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Signal peptidase I; Recombinant Mycobacterium tuberculosis Signal peptidase I; Leader peptidase I; lepB recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
88-294aa; Extracellular Domain
Sequence
RPYLIPSESMEPTLHGCSTCVGDRIMVDKLSYRFGSPQPGDVIVFRGPPSWNVGYKSIRSHNVAVRWVQNALSFIGFVPPDENDLVKRVIAVGGQTVQCRSDTGLTVNGRPLKEPYLDPATMMADPSIYPCLGSEFGPVTVPPGRVWVMGDNRTHSADSRAHCPLLCTDDPLPGTVPVANVIGKARLIVWPPSRWGVVRSVNPQQGR
Sequence Length
294
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
References
Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.Kelkar D.S., Kumar D., Kumar P., Balakrishnan L., Muthusamy B., Yadav A.K., Shrivastava P., Marimuthu A., Anand S., Sundaram H., Kingsbury R., Harsha H.C., Nair B., Prasad T.S., Chauhan D.S., Katoch K., Katoch V.M., Kumar P., Chaerkady R., Ramachandran S., Dash D., Pandey A.Mol. Cell. Proteomics 10:M111.011627-M111.011627(2011)
Inhibition of the sole type I signal peptidase of Mycobacterium tuberculosis is bactericidal under replicating and nonreplicating conditions.Ollinger J., O'Malley T., Ahn J., Odingo J., Parish T.J. Bacteriol. 194:2614-2619(2012)
Inhibition of the sole type I signal peptidase of Mycobacterium tuberculosis is bactericidal under replicating and nonreplicating conditions.Ollinger J., O'Malley T., Ahn J., Odingo J., Parish T.J. Bacteriol. 194:2614-2619(2012)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
24.6 kDa
NCBI Official Full Name
signal peptidase
NCBI Official Symbol
lepB
NCBI Protein Information
signal peptidase
UniProt Protein Name
Signal peptidase I
Protein Family
UniProt Gene Name
lepB
UniProt Synonym Gene Names
SPase I
UniProt Entry Name
LEP_MYCTU
Uniprot Description
MiscellaneousWas identified as a high-confidence drug target.
Similar Products
Product Notes
The lepB lepb (Catalog #AAA1302881) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 88-294aa; Extracellular Domain. The amino acid sequence is listed below: RPYLIPSESM EPTLHGCSTC VGDRIMVDKL SYRFGSPQPG DVIVFRGPPS WNVGYKSIRS HNVAVRWVQN ALSFIGFVPP DENDLVKRVI AVGGQTVQCR SDTGLTVNGR PLKEPYLDPA TMMADPSIYP CLGSEFGPVT VPPGRVWVMG DNRTHSADSR AHCPLLCTDD PLPGTVPVAN VIGKARLIVW PPSRWGVVRS VNPQQGR. It is sometimes possible for the material contained within the vial of "Signal peptidase I, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
