SDS-PAGE
Signal peptidase I (lepB) Recombinant Protein | lepB recombinant protein
Recombinant Escherichia coli Signal peptidase I (lepB), partial
Gene Names
lepB; ECK2566; JW2552; lep
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Signal peptidase I (lepB); Recombinant Escherichia coli Signal peptidase I (lepB); partial; Leader peptidase I; lepB recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
78-324aa; Partial
Sequence
RSFIYEPFQIPSGSMMPTLLIGDFILVEKFAYGIKDPIYQKTLIETGHPKRGDIVVFKYPEDPKLDYIKRAVGLPGDKVTYDPVSKELTIQPGCSSGQACENALPVTYSNVEPSDFVQTFSRRNGGEATSGFFEVPKNETKENGIRLSERKETLGDVTHRILTVPIAQDQVGMYYQQPGQQLATWIVPPGQYFMMGDNRDNSADSRYWGFVPEANLVGRATAIWMSFDKQEGEWPTGLRLSRIGGIH
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for lepB recombinant protein
Cleavage of hydrophobic, N-terminal signal or leader sequences from secreted and periplasmic proteins.
Product Categories/Family for lepB recombinant protein
References
"Sequence of the leader peptidase gene of Escherichia coli and the orientation of leader peptidase in the bacterial envelope."
Wolfe P.B., Wickner W., Goodman J.M.
J. Biol. Chem. 258:12073-12080(1983)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
43.7 kDa
NCBI Official Full Name
leader peptidase (signal peptidase I)
NCBI Official Symbol
lepB
NCBI Official Synonym Symbols
ECK2566; JW2552; lep
NCBI Protein Information
leader peptidase (signal peptidase I)
UniProt Protein Name
Signal peptidase I
Protein Family
UniProt Gene Name
lepB
UniProt Synonym Gene Names
SPase I
UniProt Entry Name
LEP_ECOLI
NCBI Description
LepB has a blocked N-terminus. [More information is available at EcoGene: EG10530]. Signal peptidase catalyzes the cleavage of the amino-terminal leader peptide from secretory proteins. [More information is available at EcoCyc: EG10530].
Research Articles on lepB
Similar Products
Product Notes
The lepB lepb (Catalog #AAA1116891) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 78-324aa; Partial. The amino acid sequence is listed below: RSFIYEPFQI PSGSMMPTLL IGDFILVEKF AYGIKDPIYQ KTLIETGHPK RGDIVVFKYP EDPKLDYIKR AVGLPGDKVT YDPVSKELTI QPGCSSGQAC ENALPVTYSN VEPSDFVQTF SRRNGGEATS GFFEVPKNET KENGIRLSER KETLGDVTHR ILTVPIAQDQ VGMYYQQPGQ QLATWIVPPG QYFMMGDNRD NSADSRYWGF VPEANLVGRA TAIWMSFDKQ EGEWPTGLRL SRIGGIH . It is sometimes possible for the material contained within the vial of "Signal peptidase I (lepB), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
