Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Left-right determination factor 1 (Lefty1) Recombinant Protein | Lefty1 recombinant protein

Recombinant Mouse Left-right determination factor 1 (Lefty1)

Gene Names
Lefty1; Ebaf; Leftb; Stra3; Tgfb4; lefty; lefty-1; AI450052
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Left-right determination factor 1 (Lefty1); Recombinant Mouse Left-right determination factor 1 (Lefty1); Lefty1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
77-368, full length protein
Sequence
RFSQNLREVAGRFLVSETSTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPRTALRRQKRLSPHSARARVTIEWLRFRDDGSNRTALIDSRLVSIHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPGTWSSHKLVRFAAQGTPDGKGQGEPQLELHTLDLKDYGAQGNCDPEAPVTEGTRCCRQEMYLDLQGMKWAENWILEPPGFLTYECVGSCLQLPESLTSRWPFLGPRQCVASEMTSLPMIVSVKEGGRTRPQVVSLPNMRVQTCSCASDGALIPRRLQP
Sequence Length
292
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Lefty1 recombinant protein
This gene encodes a member of the TGF-beta family of proteins. A similar secreted protein in mouse plays a role in left-right asymmetry determination of organ systems during development. Alternative processing of this protein can yield three different products. This gene is closely linked to both a related family member and a related pseudogene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41,498 Da
NCBI Official Full Name
left-right determination factor 1 preproprotein
NCBI Official Synonym Full Names
left right determination factor 1
NCBI Official Symbol
Lefty1
NCBI Official Synonym Symbols
Ebaf; Leftb; Stra3; Tgfb4; lefty; lefty-1; AI450052
NCBI Protein Information
left-right determination factor 1
UniProt Protein Name
Left-right determination factor 1
UniProt Gene Name
Lefty1
UniProt Synonym Gene Names
Ebaf; Lefty; Stra3; Tgfb4; Lefty protein; TGF-beta-4

NCBI Description

This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate the mature protein, which plays a role in left-right asymmetry determination of organ systems during development. Mice lacking a functional copy of this gene exhibit embryonic lethality and defects in left-right patterning. [provided by RefSeq, Aug 2016]

Uniprot Description

Required for left-right axis determination as a regulator of LEFTY2 and NODAL.

Research Articles on Lefty1

Similar Products

Product Notes

The Lefty1 lefty1 (Catalog #AAA1476694) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 77-368, full length protein. The amino acid sequence is listed below: RFSQNLREVA GRFLVSETST HLLVFGMEQR LPPNSELVQA VLRLFQEPVP RTALRRQKRL SPHSARARVT IEWLRFRDDG SNRTALIDSR LVSIHESGWK AFDVTEAVNF WQQLSRPRQP LLLQVSVQRE HLGPGTWSSH KLVRFAAQGT PDGKGQGEPQ LELHTLDLKD YGAQGNCDPE APVTEGTRCC RQEMYLDLQG MKWAENWILE PPGFLTYECV GSCLQLPESL TSRWPFLGPR QCVASEMTSL PMIVSVKEGG RTRPQVVSLP NMRVQTCSCA SDGALIPRRL QP. It is sometimes possible for the material contained within the vial of "Left-right determination factor 1 (Lefty1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.