SDS-Page
L-lactate dehydrogenase A chain (LDHA) Recombinant Protein | LDHA recombinant protein
Recombinant Human L-lactate dehydrogenase A chain (LDHA), partial
Gene Names
LDHA; LDHM; GSD11; PIG19; HEL-S-133P
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
L-lactate dehydrogenase A chain (LDHA); Recombinant Human L-lactate dehydrogenase A chain (LDHA); partial; Cell proliferation-inducing gene 19 protein; LDH muscle subunit; LDHA recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
5-323aa; Partial
Sequence
KDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTL
Organism
Homo sapiens (Human)
Tag Information
NO-tagged
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C.
The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C.
The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
SDS-Page
SDS-Page
Product Categories/Family for LDHA recombinant protein
References
"Genotypic analysis of families with lactate dehydrogenase A (M) deficiency by selective DNA amplification." Maekawa M., Sudo K., Li S.S., Kanno T.Hum. Genet. 88:34-38 (1991)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
35.1 kDa
NCBI Official Full Name
L-lactate dehydrogenase A chain isoform 2
NCBI Official Synonym Full Names
lactate dehydrogenase A
NCBI Official Symbol
LDHA
NCBI Official Synonym Symbols
LDHM; GSD11; PIG19; HEL-S-133P
NCBI Protein Information
L-lactate dehydrogenase A chain
UniProt Protein Name
L-lactate dehydrogenase A chain
Protein Family
UniProt Gene Name
LDHA
UniProt Synonym Gene Names
LDH-A; LDH-M
NCBI Description
The protein encoded by this gene catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. The protein is found predominantly in muscle tissue and belongs to the lactate dehydrogenase family. Mutations in this gene have been linked to exertional myoglobinuria. Multiple transcript variants encoding different isoforms have been found for this gene. The human genome contains several non-transcribed pseudogenes of this gene. [provided by RefSeq, Sep 2008]
Research Articles on LDHA
Similar Products
Product Notes
The LDHA ldha (Catalog #AAA7110874) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 5-323aa; Partial with tag NO-tagged. The amino acid sequence is listed below: KDQLIYNLLK EEQTPQNKIT VVGVGAVGMA CAISILMKDL ADELALVDVI EDKLKGEMMD LQHGSLFLRT PKIVSGKDYN VTANSKLVII TAGARQQEGE SRLNLVQRNV NIFKFIIPNV VKYSPNCKLL IVSNPVDILT YVAWKISGFP KNRVIGSGCN LDSARFRYLM GERLGVHPLS CHGWVLGEHG DSSVPVWSGM NVAGVSLKTL HPDLGTDKDK EQWKEVHKQV VESAYEVIKL KGYTSWAIGL SVADLAESIM KNLRRVHPVS TMIKGLYGIK DDVFLSVPCI LGQNGISDLV KVTLTSEEEA RLKKSADTL . It is sometimes possible for the material contained within the vial of "L-lactate dehydrogenase A chain (LDHA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
