Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Cytosol aminopeptidase Recombinant Protein | LAP3 recombinant protein

Recombinant Bovine Cytosol aminopeptidase

Gene Names
LAP3; PEPS; LAP-3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cytosol aminopeptidase; Recombinant Bovine Cytosol aminopeptidase; Leucine aminopeptidase 3; LAP-3; Leucyl aminopeptidase; Peptidase S; Proline aminopeptidase (EC:3.4.11.5)Prolyl aminopeptidase; LAP3 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
25-64aa; Full Length
Sequence
VRNSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCRRK
Sequence Length
519
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for LAP3 recombinant protein
Presumably involved in the processing and regular turnover of intracellular proteins. Catalyzes the roval of unsubstituted N-terminal amino acids from various peptides.
References
The genome sequence of taurine cattle a window to ruminant biology and evolution.The bovine genome sequencing and analysis consortiumScience 324:522-528(2009) Sulfhydryl content of bovine eye lens leucine aminopeptidase. Determination of the reactivity of the sulfhydryl groups of the zinc metalloenzyme, of the enzyme activated by Mg2+, Mn2+, and Co2+, and of the metal-free apoenzyme.Cuypers H.T., van Loon-Klaassen L.A.H., Vree Egberts W.T.M., de Jong W.W., Bloemendal H.J. Biol. Chem. 257:7086-7091(1982) Seroussi E. Molecular structure of leucine aminopeptidase at 2.7-A resolution.Burley S.K., David P.R., Taylor A., Lipscomb W.N.Proc. Natl. Acad. Sci. U.S.A. 87:6878-6882(1990) Structure determination and refinement of bovine lens leucine aminopeptidase and its complex with bestatin.Burley S.K., David P.R., Sweet R.M., Taylor A., Lipscomb W.N.J. Mol. Biol. 224:113-140(1992) Two-metal ion mechanism of bovine lens leucine aminopeptidase active site solvent structure and binding mode of L-leucinal, a gem-diolate transition state analogue, by X-ray crystallography.Straeter N., Lipscomb W.N.Biochemistry 34:14792-14800(1995)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20.3 kDa
NCBI Official Full Name
cytosol aminopeptidase
NCBI Official Symbol
LAP3
NCBI Official Synonym Symbols
PEPS; LAP-3
NCBI Protein Information
cytosol aminopeptidase
UniProt Protein Name
Cytosol aminopeptidase
Protein Family
UniProt Gene Name
LAP3
UniProt Synonym Gene Names
LAP-3
UniProt Entry Name
AMPL_BOVIN

Uniprot Description

LAP3: Presumably involved in the processing and regular turnover of intracellular proteins. Catalyzes the removal of unsubstituted N-terminal amino acids from various peptides. Belongs to the peptidase M17 family. 2 isoforms of the human protein are produced by alternative initiation.

Protein type: EC 3.4.11.5; Mitochondrial; Amino Acid Metabolism - arginine and proline; Protease; Other Amino Acids Metabolism - glutathione; EC 3.4.11.1

Cellular Component: focal adhesion; mitochondrion; nucleoplasm

Molecular Function: aminopeptidase activity; manganese ion binding; metalloexopeptidase activity; peptidase activity

Biological Process: proteolysis

Research Articles on LAP3

Similar Products

Product Notes

The LAP3 lap3 (Catalog #AAA969720) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 25-64aa; Full Length. The amino acid sequence is listed below: VRNSQSCRRN KGICVPIRCP GSMRQIGTCL GAQVKCCRRK. It is sometimes possible for the material contained within the vial of "Cytosol aminopeptidase, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.