Glutathione S-transferase LANCL1 (LANCL1) Recombinant Protein | LANCL1 recombinant protein
Recombinant Human Glutathione S-transferase LANCL1 (LANCL1)
Gene Names
LANCL1; p40; GPR69A
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Glutathione S-transferase LANCL1 (LANCL1); Recombinant Human Glutathione S-transferase LANCL1 (LANCL1); LANCL1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-399. Full Length of Mature Protein
Sequence
AQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQMERGLKSADPRDGTGYTGWAGIAVLYLHLYDVFGDPAYLQLAHGYVKQSLNCLTKRSITFLCGDAGPLAVAAVLYHKMNNEKQAEDCITRLIHLNKIDPHAPNEMLYGRIGYIYALLFVNKNFGVEKIPQSHIQQICETILTSGENLARKRNFTAKSPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVSQGKLHSLVKPSVDYVCQLKFPSGNYPPCIGDNRDLLVHWCHGAPGVIYMLIQAYKVFREEKYLCDAYQCADVIWQYGLLKKGYGLCHGSAGNAYAFLTLYNLTQDMKYLYRACKFAEWCLEYGEHGCRTPDTPFSLFEGMAGTIYFLADLLVPTKARFPAFEL
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for LANCL1 recombinant protein
This gene encodes a loosely associated peripheral membrane protein related to the LanC family of bacterial membrane-associated proteins involved in the biosynthesis of antimicrobial peptides. This protein may play a role as a peptide-modifying enzyme component in eukaryotic cells. Previously considered a member of the G-protein-coupled receptor superfamily, this protein is now in the LanC family. Multiple alternatively spliced variants, encoding the same protein, have been identified.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52.6 kDa
NCBI Official Full Name
lanC-like protein 1
NCBI Official Synonym Full Names
LanC like 1
NCBI Official Symbol
LANCL1
NCBI Official Synonym Symbols
p40; GPR69A
NCBI Protein Information
lanC-like protein 1
UniProt Protein Name
LanC-like protein 1
Protein Family
UniProt Gene Name
LANCL1
UniProt Synonym Gene Names
GPR69A; p40
NCBI Description
This gene encodes a loosely associated peripheral membrane protein related to the LanC family of bacterial membrane-associated proteins involved in the biosynthesis of antimicrobial peptides. This protein may play a role as a peptide-modifying enzyme component in eukaryotic cells. Previously considered a member of the G-protein-coupled receptor superfamily, this protein is now in the LanC family. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Nov 2008]
Uniprot Description
May play a role in EPS8 signaling. Binds glutathione.
Research Articles on LANCL1
Similar Products
Product Notes
The LANCL1 lancl1 (Catalog #AAA1009100) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-399. Full Length of Mature Protein. The amino acid sequence is listed below: AQRAFPNPYA DYNKSLAEGY FDAAGRLTPE FSQRLTNKIR ELLQQMERGL KSADPRDGTG YTGWAGIAVL YLHLYDVFGD PAYLQLAHGY VKQSLNCLTK RSITFLCGDA GPLAVAAVLY HKMNNEKQAE DCITRLIHLN KIDPHAPNEM LYGRIGYIYA LLFVNKNFGV EKIPQSHIQQ ICETILTSGE NLARKRNFTA KSPLMYEWYQ EYYVGAAHGL AGIYYYLMQP SLQVSQGKLH SLVKPSVDYV CQLKFPSGNY PPCIGDNRDL LVHWCHGAPG VIYMLIQAYK VFREEKYLCD AYQCADVIWQ YGLLKKGYGL CHGSAGNAYA FLTLYNLTQD MKYLYRACKF AEWCLEYGEH GCRTPDTPFS LFEGMAGTIY FLADLLVPTK ARFPAFEL . It is sometimes possible for the material contained within the vial of "Glutathione S-transferase LANCL1 (LANCL1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
