Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Laminin subunit beta-3 (LAMB3) Recombinant Protein | LAMB3 recombinant protein

Recombinant Human Laminin subunit beta-3 (LAMB3) , partial

Gene Names
LAMB3; AI1A; LAM5; LAMNB1; BM600-125KDA
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Laminin subunit beta-3 (LAMB3); Recombinant Human Laminin subunit beta-3 (LAMB3); partial; LAMB3 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
22-249aa; Partial
Sequence
SRGACYPPVGDLLVGRTRFLRASSTCGLTKPETYCTQYGEWQMKCCKCDSRQPHNYYSHRVENVASSSGPMRWWQSQNDVNPVSLQLDLDRRFQLQEVMMEFQGPMPAGMLIERSSDFGKTWRVYQYLAADCTSTFPRVRQGRPQSWQDVRCQSLPQRPNARLNGGKVQLNLMDLVSGIPATQSQKIQEVGEITNLRVNFTRLAPVPQRGYHPPSAYYAVSQLRLQGS
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for LAMB3 recombinant protein
The product encoded by this gene is a laminin that belongs to a family of basement membrane proteins. This protein is a beta subunit laminin, which together with an alpha and a gamma subunit, forms laminin-5. Mutations in this gene cause epidermolysis bullosa junctional Herlitz type, and generalized atrophic benign epidermolysis bullosa, diseases that are characterized by blistering of the skin. Multiple alternatively spliced transcript variants that encode the same protein have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
129,572 Da
NCBI Official Full Name
laminin subunit beta-3
NCBI Official Synonym Full Names
laminin subunit beta 3
NCBI Official Symbol
LAMB3
NCBI Official Synonym Symbols
AI1A; LAM5; LAMNB1; BM600-125KDA
NCBI Protein Information
laminin subunit beta-3
UniProt Protein Name
Laminin subunit beta-3
Protein Family
UniProt Gene Name
LAMB3
UniProt Synonym Gene Names
LAMNB1

NCBI Description

The product encoded by this gene is a laminin that belongs to a family of basement membrane proteins. This protein is a beta subunit laminin, which together with an alpha and a gamma subunit, forms laminin-5. Mutations in this gene cause epidermolysis bullosa junctional Herlitz type, and generalized atrophic benign epidermolysis bullosa, diseases that are characterized by blistering of the skin. Multiple alternatively spliced transcript variants that encode the same protein have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components.

Research Articles on LAMB3

Similar Products

Product Notes

The LAMB3 lamb3 (Catalog #AAA1469814) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-249aa; Partial. The amino acid sequence is listed below: SRGACYPPVG DLLVGRTRFL RASSTCGLTK PETYCTQYGE WQMKCCKCDS RQPHNYYSHR VENVASSSGP MRWWQSQNDV NPVSLQLDLD RRFQLQEVMM EFQGPMPAGM LIERSSDFGK TWRVYQYLAA DCTSTFPRVR QGRPQSWQDV RCQSLPQRPN ARLNGGKVQL NLMDLVSGIP ATQSQKIQEV GEITNLRVNF TRLAPVPQRG YHPPSAYYAV SQLRLQGS . It is sometimes possible for the material contained within the vial of "Laminin subunit beta-3 (LAMB3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.