Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Laminin subunit alpha-4 (LAMA4), partial Recombinant Protein | LAMA4 recombinant protein

Recombinant Human Laminin subunit alpha-4 (LAMA4), partial

Gene Names
LAMA4; LAMA3; CMD1JJ; LAMA4*-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Laminin subunit alpha-4 (LAMA4); partial; Recombinant Human Laminin subunit alpha-4 (LAMA4); Laminin subunit alpha-4; Laminin-14 subunit alpha; Laminin-8 subunit alpha; Laminin-9 subunit alpha; LAMA4 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
82-255aa; Partial, include the Laminin EGF-like 1-4 domians
Sequence
CDCNGNSNECLDGSGYCVHCQRNTTGEHCEKCLDGYIGDSIRGAPQFCQPCPCPLPHLANFAESCYRKNGAVRCICNENYAGPNCERCAPGYYGNPLLIGSTCKKCDCSGNSDPNLIFEDCDEVTGQCRNCLRNTTGFKCERCAPGYYGDARIAKNCAVCNCGGGPCDSVTGEC
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12,819 Da
NCBI Official Full Name
laminin subunit alpha-4 isoform 1
NCBI Official Synonym Full Names
laminin, alpha 4
NCBI Official Symbol
LAMA4
NCBI Official Synonym Symbols
LAMA3; CMD1JJ; LAMA4*-1
NCBI Protein Information
laminin subunit alpha-4; laminin alpha 4 chain
UniProt Protein Name
Laminin subunit alpha-4
Protein Family
UniProt Gene Name
LAMA4
UniProt Entry Name
LAMA4_HUMAN

NCBI Description

Laminins, a family of extracellular matrix glycoproteins, are the major noncollagenous constituent of basement membranes. They have been implicated in a wide variety of biological processes including cell adhesion, differentiation, migration, signaling, neurite outgrowth and metastasis. Laminins are composed of 3 non identical chains: laminin alpha, beta and gamma (formerly A, B1, and B2, respectively) and they form a cruciform structure consisting of 3 short arms, each formed by a different chain, and a long arm composed of all 3 chains. Each laminin chain is a multidomain protein encoded by a distinct gene. Several isoforms of each chain have been described. Different alpha, beta and gamma chain isomers combine to give rise to different heterotrimeric laminin isoforms which are designated by Arabic numerals in the order of their discovery, i.e. alpha1beta1gamma1 heterotrimer is laminin 1. The biological functions of the different chains and trimer molecules are largely unknown, but some of the chains have been shown to differ with respect to their tissue distribution, presumably reflecting diverse functions in vivo. This gene encodes the alpha chain isoform laminin, alpha 4. The domain structure of alpha 4 is similar to that of alpha 3, both of which resemble truncated versions of alpha 1 and alpha 2, in that approximately 1,200 residues at the N-terminus (domains IV, V and VI) have been lost. Laminin, alpha 4 contains the C-terminal G domain which distinguishes all alpha chains from the beta and gamma chains. The RNA analysis from adult and fetal tissues revealed developmental regulation of expression, however, the exact function of laminin, alpha 4 is not known. Tissue-specific utilization of alternative polyA-signal has been described in literature. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Aug 2011]

Uniprot Description

LAMA4: Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Extracellular matrix; Motility/polarity/chemotaxis; Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 6q21

Cellular Component: extracellular matrix; laminin-1 complex; extracellular region; basement membrane; basal lamina

Molecular Function: protein binding; extracellular matrix structural constituent; receptor binding

Biological Process: regulation of cell adhesion; extracellular matrix organization and biogenesis; regulation of embryonic development; cell adhesion; regulation of cell migration

Disease: Cardiomyopathy, Dilated, 1jj

Research Articles on LAMA4

Similar Products

Product Notes

The LAMA4 lama4 (Catalog #AAA1330795) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 82-255aa; Partial, include the Laminin EGF-like 1-4 domians. The amino acid sequence is listed below: CDCNGNSNEC LDGSGYCVHC QRNTTGEHCE KCLDGYIGDS IRGAPQFCQP CPCPLPHLAN FAESCYRKNG AVRCICNENY AGPNCERCAP GYYGNPLLIG STCKKCDCSG NSDPNLIFED CDEVTGQCRN CLRNTTGFKC ERCAPGYYGD ARIAKNCAVC NCGGGPCDSV TGEC. It is sometimes possible for the material contained within the vial of "Laminin subunit alpha-4 (LAMA4), partial, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.