Alpha-lactalbumin (LALBA) Recombinant Protein | LALBA recombinant protein
Recombinant Dog Alpha-lactalbumin (LALBA)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Alpha-lactalbumin (LALBA); Recombinant Dog Alpha-lactalbumin (LALBA); LALBA recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
20-142, Full length protein
Sequence
KQFTKCELPQVLKDMDGFGGIALPEWICTIFHTSGYDTQTIVNNNGGTDYGLFQISNKFWCKDDQNLQSRNICDISCDKFLDDDLTDDMICAKKILDKEGIDYWLAHKPLCSEKLEQWRCEKL
Sequence Length
123
Species
Canis familiaris (Dog) (Canis lupus familiaris)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for LALBA recombinant protein
This gene encodes alpha-lactalbumin, a principal protein of milk. Alpha-lactalbumin forms the regulatory subunit of the lactose synthase (LS) heterodimer and beta 1,4-galactosyltransferase (beta4Gal-T1) forms the catalytic component. Together, these proteins enable LS to produce lactose by transfering galactose moieties to glucose. As a monomer, alpha-lactalbumin strongly binds calcium and zinc ions and may possess bactericidal or antitumor activity. A folding variant of alpha-lactalbumin, called HAMLET, likely induces apoptosis in tumor and immature cells.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16,285 Da
NCBI Official Full Name
alpha-lactalbumin
NCBI Official Synonym Full Names
lactalbumin alpha
NCBI Official Symbol
LALBA
NCBI Protein Information
alpha-lactalbumin
UniProt Protein Name
Alpha-lactalbumin
Protein Family
UniProt Gene Name
LALBA
Uniprot Description
Regulatory subunit of lactose synthase, changes the substrate specificity of galactosyltransferase in the mammary gland making glucose a good acceptor substrate for this enzyme. This enables LS to synthesize lactose, the major carbohydrate component of milk. In other tissues, galactosyltransferase transfers galactose onto the N-acetylglucosamine of the oligosaccharide chains in glycoproteins.
Similar Products
Product Notes
The LALBA lalba (Catalog #AAA1355001) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 20-142, Full length protein. The amino acid sequence is listed below: KQFTKCELPQ VLKDMDGFGG IALPEWICTI FHTSGYDTQT IVNNNGGTDY GLFQISNKFW CKDDQNLQSR NICDISCDKF LDDDLTDDMI CAKKILDKEG IDYWLAHKPL CSEKLEQWRC EKL. It is sometimes possible for the material contained within the vial of "Alpha-lactalbumin (LALBA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
