Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

L5 homolog (FPV132) Recombinant Protein | FPV132 recombinant protein

Recombinant Fowlpox virus L5 homolog (FPV132)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
L5 homolog (FPV132); Recombinant Fowlpox virus L5 homolog (FPV132); Recombinant L5 homolog (FPV132); L5 homolog; Protein FPV132; FPV132 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-129
Sequence
MDRNINFSPVFIEPRFKHEFLLSPQRYFYILVFEVIVALIILNFFFKEEILYTFFPLAKPSKNSINSLLDRTMLKCEEDGSLMISRPSGIYSALSLDGSPVRISDCSLLLSSINGASSSTSPYSIFNRR
Sequence Length
129
Species
Fowlpox virus (strain NVSL) (FPV)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14,745 Da
NCBI Official Full Name
hypothetical protein FPV132
NCBI Official Symbol
FPV132
NCBI Protein Information
hypothetical protein
UniProt Protein Name
L5 homolog
Protein Family
L5
UniProt Entry Name
L5_FOWPN

Uniprot Description

Function: Envelope protein part of the entry-fusion complex responsible for the virus membrane fusion with host cell membrane during virus entry. Also plays a role in cell-cell fusion (syncytium formation)

By similarity.

Subunit structure: Part of a stable entry-fusion complex (EFC) which is at least composed of proteins A16, A21, A28, G3, G9, H2, J5, and L5. Formation of the viral membrane is necessary for the assembly of the complex. Interacts with G3

By similarity.

Subcellular location: Virion membrane

By similarity; Single-pass type III membrane protein

Potential. Note: Component of the mature virion (MV) membrane

By similarity. The mature virion is located in the cytoplasm of infected cells and is probably released by cell lysis.

Induction: Expressed in the late phase of the viral replicative cycle.

Post-translational modification: Most cysteines are linked by disulfide bonds. They are created by the viral disulfide bond formation pathway, a poxvirus-specific redox pathway that operates on the cytoplasmic side of the MV membranes

By similarity.

Sequence similarities: Belongs to the chordopoxvirinae L5 family.

Similar Products

Product Notes

The FPV132 (Catalog #AAA1085965) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-129. The amino acid sequence is listed below: MDRNINFSPV FIEPRFKHEF LLSPQRYFYI LVFEVIVALI ILNFFFKEEI LYTFFPLAKP SKNSINSLLD RTMLKCEEDG SLMISRPSGI YSALSLDGSP VRISDCSLLL SSINGASSST SPYSIFNRR. It is sometimes possible for the material contained within the vial of "L5 homolog (FPV132), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.