RNA-directed RNA polymerase L (L), partial Recombinant Protein | L recombinant protein

Recombinant Zaire ebolavirus RNA-directed RNA polymerase L (L), partial

Cat. Num. AAA1414035

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: RNA-directed RNA polymerase L (L); partial; Recombinant Zaire ebolavirus RNA-directed RNA polymerase L (L); RNA-directed RNA polymerase L; Protein L; Large structural protein; Replicase; Transcriptase; Including the following 3 domains:; RNA-directed RNA polymerase; EC=2.7.7.48; mRNA (guanine-N(7)-)-methyltransferase; EC=2.1.1.56; mRNA guanylyltransferase; EC=2; L recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 625-809aa; Partial
• Sequence: RGSSFVTDLEKYNLAFRYEFTAPFIEYCNRCYGVKNVFNWMHYTIPQCYMHVSDYYNPPHNLTLENRDNPPEGPSSYRGHMGGIEGLQQKLWTSISCAQISLVEIKTGFKLRSAVMGDNQCITVLSVFPLETDADEQEQSAEDNAARVAASLAKVTSACGIFLKPDETFVHSGFIYFGKKQYLNG
• Sequence Length: 809

• Species: Zaire ebolavirus (strain Kikwit-95) (ZEBOV) (Zaire Ebola virus)
• Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-Page

Related Product Information for L recombinant protein

RNA-directed RNA polymerase that catalyzes the transcription of viral mRNAs, their capping and polyadenylation. The template is composed of the viral RNA tightly encapsidated by the nucleoprotein (N). The viral polymerase binds to the genomic RNA at the 3' leader promoter, and transcribes subsequently all viral mRNAs with a decreasing efficiency. The first gene is the most transcribed, and the last the least transcribed. The viral phosphoprotein acts as a processivity factor. Capping is concommitant with initiation of mRNA transcription. Indeed, a GDP polyribonucleotidyl transferase (PRNTase) adds the cap structure when the nascent RNA chain length has reached few nucleotides. Ribose 2'-O methylation of viral mRNA cap precedes and facilitates subsequent guanine-N-7 methylation, both activities being carried by the viral polymerase. Polyadenylation of mRNAs occur by a stuttering mechanism at a slipery stop site present at the end viral genes. After finishing transcription of a mRNA, the polymerase can resume transcription of the downstream gene.

NCBI and Uniprot Product Information

• NCBI GI #: 75548697
• UniProt Accession #: Q6V1Q2
• Molecular Weight: 27.9 kDa
• NCBI Official Full Name: RNA-directed RNA polymerase L
• UniProt Protein Name: RNA-directed RNA polymerase L
• UniProt Gene Name: L
• UniProt Synonym Gene Names: Protein L
• UniProt Entry Name: L_EBOZ5

Uniprot Description

Displays RNA-directed RNA polymerase, mRNA guanylyl transferase, mRNA (guanine-N(7)-)-methyltransferase and poly(A) synthetase activities. The viral mRNA guanylyl transferase displays a different biochemical reaction than the cellular enzyme. The template is composed of the viral RNA tightly encapsidated by the nucleoprotein (N). Functions either as transcriptase or as replicase. The transcriptase synthesizes subsequently subgenomic RNAs, assuring their capping and polyadenylation by a stuttering mechanism. The transcriptase stutters on a specific sequence, resulting on a cotranscriptional editing of the glycoprotein (GP) mRNA. The replicase mode is dependent on intracellular N protein concentration. In this mode, the polymerase replicates the whole viral genome without recognizing the transcriptional signals ().