Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

L-lactate dehydrogenase A chain Recombinant Protein | LDHA recombinant protein

Recombinant human L-lactate dehydrogenase A chain

Gene Names
LDHA; LDHM; GSD11; PIG19; HEL-S-133P
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
L-lactate dehydrogenase A chain; Recombinant human L-lactate dehydrogenase A chain; Recombinant human L-lactate dehydrogenase A chain protein; LDHA recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence
KDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTL
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for LDHA recombinant protein
(S)-lactate + NAD+ = pyruvate + NADH.
References
[1] "Nucleotide sequences of the cDNA and an intronless pseudogene for human lactate dehydrogenase-A isozyme."

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
62 KD
NCBI Official Full Name
L-lactate dehydrogenase A chain isoform 3
NCBI Official Synonym Full Names
lactate dehydrogenase A
NCBI Official Symbol
LDHA
NCBI Official Synonym Symbols
LDHM; GSD11; PIG19; HEL-S-133P
NCBI Protein Information
L-lactate dehydrogenase A chain
Protein Family

Research Articles on LDHA

Similar Products

Product Notes

The LDHA (Catalog #AAA954822) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: KDQLIYNLLK EEQTPQNKIT VVGVGAVGMA CAISILMKDL ADELALVDVI EDKLKGEMMD LQHGSLFLRT PKIVSGKDYN VTANSKLVII TAGARQQEGE SRLNLVQRNV NIFKFIIPNV VKYSPNCKLL IVSNPVDILT YVAWKISGFP KNRVIGSGCN LDSARFRYLM GERLGVHPLS CHGWVLGEHG DSSVPVWSGM NVAGVSLKTL HPDLGTDKDK EQWKEVHKQV VESAYEVIKL KGYTSWAIGL SVADLAESIM KNLRRVHPVS TMIKGLYGIK DDVFLSVPCI LGQNGISDLV KVTLTSEEEA RLKKSADTL. It is sometimes possible for the material contained within the vial of "L-lactate dehydrogenase A chain, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.