Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Keratin, type II cuticular Hb4 (KRT84) Recombinant Protein | KRT84 recombinant protein

Recombinant Human Keratin, type II cuticular Hb4 (KRT84)

Gene Names
KRT84; HB4; KRTHB4
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Keratin; type II cuticular Hb4 (KRT84); Recombinant Human Keratin; KRT84 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-600, Full length protein
Sequence
MSCRSYRVSSGHRVGNFSSCSAMTPQNLNRFRANSVSCWSGPGFRGLGSFGSRSVITFGSYSPRIAAVGSRPIHCGVRFGAGCGMGFGDGRGVGLGPRADSCVGLGFGAGSGIGYGFGGPGFGYRVGGVGVPAAPSITAVTVNKSLLTPLNLEIDPNAQRVKKDEKEQIKTLNNKFASFIDKVRFLEQQNKLLETKWSFLQEQKCIRSNLEPLFESYITNLRRQLEVLVSDQARLQAERNHLQDVLEGFKKKYEEEVVCRANAENEFVALKKDVDAAFMNKSDLEANVDTLTQEIDFLKTLYMEEIQLLQSHISETSVIVKMDNSRDLNLDGIIAEVKAQYEEVARRSRADAEAWYQTKYEEMQVTAGQHCDNLRNIRNEINELTRLIQRLKAEIEHAKAQRAKLEAAVAEAEQQGEATLSDAKCKLADLECALQQAKQDMARQLCEYQELMNAKLGLDIEIATYRRLLEGEESRLCEGVGPVNISVSSSRGGLVCGPEPLVAGSTLSRGGVTFSGSSSVCATSGVLASCGPSLGGARVAPATGDLLSTGTRSGSMLISEACVPSVPCPLPTQGGFSSCSGGRSSSVRFVSTTTSCRTKY
Sequence Length
600
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for KRT84 recombinant protein
This protein is a member of the keratin gene family. As a type II hair keratin, it is a basic protein which heterodimerizes with type I keratins to form hair and nails. The type II hair keratins are clustered in a region of chromosome 12q13 and are grouped into two distinct subfamilies based on structure similarity. One subfamily, consisting of KRTHB1, KRTHB3, and KRTHB6, is highly related. The other less-related subfamily includes KRTHB2, KRTHB4, and KRTHB5. All hair keratins are expressed in the hair follicle; this hair keratin is contained primarily in the filiform tongue papilla, among other hair keratins.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64,842 Da
NCBI Official Full Name
keratin, type II cuticular Hb4
NCBI Official Synonym Full Names
keratin 84
NCBI Official Symbol
KRT84
NCBI Official Synonym Symbols
HB4; KRTHB4
NCBI Protein Information
keratin, type II cuticular Hb4
UniProt Protein Name
Keratin, type II cuticular Hb4
Protein Family
UniProt Gene Name
KRT84
UniProt Synonym Gene Names
KRTHB4; K84

NCBI Description

The protein encoded by this gene is a member of the keratin gene family. As a type II hair keratin, it is a basic protein which heterodimerizes with type I keratins to form hair and nails. The type II hair keratins are clustered in a region of chromosome 12q13 and are grouped into two distinct subfamilies based on structure similarity. One subfamily, consisting of KRTHB1, KRTHB3, and KRTHB6, is highly related. The other less-related subfamily includes KRTHB2, KRTHB4, and KRTHB5. All hair keratins are expressed in the hair follicle; this hair keratin is contained primarily in the filiform tongue papilla, among other hair keratins. [provided by RefSeq, Jul 2008]

Uniprot Description

MiscellaneousThere are two types of hair/microfibrillar keratin, I (acidic) and II (neutral to basic).

Similar Products

Product Notes

The KRT84 krt84 (Catalog #AAA1369862) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-600, Full length protein. The amino acid sequence is listed below: MSCRSYRVSS GHRVGNFSSC SAMTPQNLNR FRANSVSCWS GPGFRGLGSF GSRSVITFGS YSPRIAAVGS RPIHCGVRFG AGCGMGFGDG RGVGLGPRAD SCVGLGFGAG SGIGYGFGGP GFGYRVGGVG VPAAPSITAV TVNKSLLTPL NLEIDPNAQR VKKDEKEQIK TLNNKFASFI DKVRFLEQQN KLLETKWSFL QEQKCIRSNL EPLFESYITN LRRQLEVLVS DQARLQAERN HLQDVLEGFK KKYEEEVVCR ANAENEFVAL KKDVDAAFMN KSDLEANVDT LTQEIDFLKT LYMEEIQLLQ SHISETSVIV KMDNSRDLNL DGIIAEVKAQ YEEVARRSRA DAEAWYQTKY EEMQVTAGQH CDNLRNIRNE INELTRLIQR LKAEIEHAKA QRAKLEAAVA EAEQQGEATL SDAKCKLADL ECALQQAKQD MARQLCEYQE LMNAKLGLDI EIATYRRLLE GEESRLCEGV GPVNISVSSS RGGLVCGPEP LVAGSTLSRG GVTFSGSSSV CATSGVLASC GPSLGGARVA PATGDLLSTG TRSGSMLISE ACVPSVPCPL PTQGGFSSCS GGRSSSVRFV STTTSCRTKY. It is sometimes possible for the material contained within the vial of "Keratin, type II cuticular Hb4 (KRT84), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.