Keratin, type II cuticular Hb2 (KRT82) Recombinant Protein | KRT82 recombinant protein

Recombinant Human Keratin, type II cuticular Hb2 (KRT82)

Cat. Num. AAA1300266

• Gene Names: KRT82; HB2; Hb-2; KRTHB2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Keratin; type II cuticular Hb2 (KRT82); Recombinant Human Keratin; KRT82 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-513, Full length protein
• Sequence: MSYHSFQPGSRCGSQSFSSYSAVMPRMVTHYAVSKGPCRPGGGRGLRALGCLGSRSLCNVGFGRPRVASRCGGTLPGFGYRLGATCGPSACITPVTINESLLVPLALEIDPTVQRVKRDEKEQIKCLNNRFASFINKVRFLEQKNKLLETKWNFMQQQRCCQTNIEPIFEGYISALRRQLDCVSGDRVRLESELCSLQAALEGYKKKYEEELSLRPCVENEFVALKKDVDTAFLMKADLETNAEALVQEIDFLKSLYEEEICLLQSQISETSVIVKMDNSRELDVDGIIAEIKAQYDDIASRSKAEAEAWYQCRYEELRVTAGNHCDNLRNRKNEILEMNKLIQRLQQETENVKAQRCKLEGAIAEAEQQGEAALNDAKCKLAGLEEALQKAKQDMACLLKEYQEVMNSKLGLDIEIATYRRLLEGEEHRLCEGIGPVNISVSSSKGAFLYEPCGVSTPVLSTGVLRSNGGCSIVGTGELYVPCEPQGLLSCGSGRKSSMTLGAGGSSPSHKH
• Sequence Length: 513

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for KRT82 recombinant protein

This protein is a member of the keratin gene family. As a type II hair keratin, it is a basic protein which heterodimerizes with type I keratins to form hair and nails. The type II hair keratins are clustered in a region of chromosome 12q13 and are grouped into two distinct subfamilies based on structure similarity. One subfamily, consisting of KRTHB1, KRTHB3, and KRTHB6, is highly related. The other less-related subfamily includes KRTHB2, KRTHB4, and KRTHB5. All hair keratins are expressed in the hair follicle; this keratin appears to be a hair cuticle-specific keratin.

NCBI and Uniprot Product Information

• NCBI GI #: 27477127
• NCBI GeneID: 3888
• NCBI Accession #: NP_149022.3
• NCBI GenBank Nucleotide #: NM_033033.3
• UniProt Accession #: Q9NSB4
• Molecular Weight: 56,653 Da
• NCBI Official Full Name: keratin, type II cuticular Hb2
• NCBI Official Synonym Full Names: keratin 82
• NCBI Official Symbol: KRT82
• NCBI Official Synonym Symbols: HB2; Hb-2; KRTHB2
• NCBI Protein Information: keratin, type II cuticular Hb2
• UniProt Protein Name: Keratin, type II cuticular Hb2
• Protein Family: Keratin
• UniProt Gene Name: KRT82
• UniProt Synonym Gene Names: KRTHB2; K82

NCBI Description

The protein encoded by this gene is a member of the keratin gene family. As a type II hair keratin, it is a basic protein which heterodimerizes with type I keratins to form hair and nails. The type II hair keratins are clustered in a region of chromosome 12q13 and are grouped into two distinct subfamilies based on structure similarity. One subfamily, consisting of KRTHB1, KRTHB3, and KRTHB6, is highly related. The other less-related subfamily includes KRTHB2, KRTHB4, and KRTHB5. All hair keratins are expressed in the hair follicle; this keratin appears to be a hair cuticle-specific keratin. [provided by RefSeq, Jul 2008]

Uniprot Description

MiscellaneousThere are two types of hair/microfibrillar keratin, I (acidic) and II (neutral to basic).