Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Keratin, type II cuticular Hb2 (KRT82) Recombinant Protein | KRT82 recombinant protein

Recombinant Human Keratin, type II cuticular Hb2 (KRT82)

Gene Names
KRT82; HB2; Hb-2; KRTHB2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Keratin; type II cuticular Hb2 (KRT82); Recombinant Human Keratin; KRT82 recombinant protein
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-513, Full length protein
Sequence
MSYHSFQPGSRCGSQSFSSYSAVMPRMVTHYAVSKGPCRPGGGRGLRALGCLGSRSLCNVGFGRPRVASRCGGTLPGFGYRLGATCGPSACITPVTINESLLVPLALEIDPTVQRVKRDEKEQIKCLNNRFASFINKVRFLEQKNKLLETKWNFMQQQRCCQTNIEPIFEGYISALRRQLDCVSGDRVRLESELCSLQAALEGYKKKYEEELSLRPCVENEFVALKKDVDTAFLMKADLETNAEALVQEIDFLKSLYEEEICLLQSQISETSVIVKMDNSRELDVDGIIAEIKAQYDDIASRSKAEAEAWYQCRYEELRVTAGNHCDNLRNRKNEILEMNKLIQRLQQETENVKAQRCKLEGAIAEAEQQGEAALNDAKCKLAGLEEALQKAKQDMACLLKEYQEVMNSKLGLDIEIATYRRLLEGEEHRLCEGIGPVNISVSSSKGAFLYEPCGVSTPVLSTGVLRSNGGCSIVGTGELYVPCEPQGLLSCGSGRKSSMTLGAGGSSPSHKH
Sequence Length
513
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for KRT82 recombinant protein
This protein is a member of the keratin gene family. As a type II hair keratin, it is a basic protein which heterodimerizes with type I keratins to form hair and nails. The type II hair keratins are clustered in a region of chromosome 12q13 and are grouped into two distinct subfamilies based on structure similarity. One subfamily, consisting of KRTHB1, KRTHB3, and KRTHB6, is highly related. The other less-related subfamily includes KRTHB2, KRTHB4, and KRTHB5. All hair keratins are expressed in the hair follicle; this keratin appears to be a hair cuticle-specific keratin.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56,653 Da
NCBI Official Full Name
keratin, type II cuticular Hb2
NCBI Official Synonym Full Names
keratin 82
NCBI Official Symbol
KRT82
NCBI Official Synonym Symbols
HB2; Hb-2; KRTHB2
NCBI Protein Information
keratin, type II cuticular Hb2
UniProt Protein Name
Keratin, type II cuticular Hb2
Protein Family
UniProt Gene Name
KRT82
UniProt Synonym Gene Names
KRTHB2; K82

NCBI Description

The protein encoded by this gene is a member of the keratin gene family. As a type II hair keratin, it is a basic protein which heterodimerizes with type I keratins to form hair and nails. The type II hair keratins are clustered in a region of chromosome 12q13 and are grouped into two distinct subfamilies based on structure similarity. One subfamily, consisting of KRTHB1, KRTHB3, and KRTHB6, is highly related. The other less-related subfamily includes KRTHB2, KRTHB4, and KRTHB5. All hair keratins are expressed in the hair follicle; this keratin appears to be a hair cuticle-specific keratin. [provided by RefSeq, Jul 2008]

Uniprot Description

MiscellaneousThere are two types of hair/microfibrillar keratin, I (acidic) and II (neutral to basic).

Similar Products

Product Notes

The KRT82 krt82 (Catalog #AAA1300266) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-513, Full length protein. The amino acid sequence is listed below: MSYHSFQPGS RCGSQSFSSY SAVMPRMVTH YAVSKGPCRP GGGRGLRALG CLGSRSLCNV GFGRPRVASR CGGTLPGFGY RLGATCGPSA CITPVTINES LLVPLALEID PTVQRVKRDE KEQIKCLNNR FASFINKVRF LEQKNKLLET KWNFMQQQRC CQTNIEPIFE GYISALRRQL DCVSGDRVRL ESELCSLQAA LEGYKKKYEE ELSLRPCVEN EFVALKKDVD TAFLMKADLE TNAEALVQEI DFLKSLYEEE ICLLQSQISE TSVIVKMDNS RELDVDGIIA EIKAQYDDIA SRSKAEAEAW YQCRYEELRV TAGNHCDNLR NRKNEILEMN KLIQRLQQET ENVKAQRCKL EGAIAEAEQQ GEAALNDAKC KLAGLEEALQ KAKQDMACLL KEYQEVMNSK LGLDIEIATY RRLLEGEEHR LCEGIGPVNI SVSSSKGAFL YEPCGVSTPV LSTGVLRSNG GCSIVGTGEL YVPCEPQGLL SCGSGRKSSM TLGAGGSSPS HKH. It is sometimes possible for the material contained within the vial of "Keratin, type II cuticular Hb2 (KRT82), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual