Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Histone-lysine N-methyltransferase MLL3 (MLL3) Recombinant Protein | KMT2C recombinant protein

Recombinant Human Histone-lysine N-methyltransferase MLL3 (MLL3) , partial

Gene Names
KMT2C; HALR; MLL3; KLEFS2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Histone-lysine N-methyltransferase MLL3 (MLL3); Recombinant Human Histone-lysine N-methyltransferase MLL3 (MLL3); partial; KMT2C recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
4689-4911. Fragment at the C-terminal.
Sequence
FRYGRNPLMELPLAVNPTGCARSEPKMSAHVKRFVLRPHTLNSTSTSKSFQSTVTGELNAPYSKQFVHSKSSQYRKMKTEWKSNVYLARSRIQGLGLYAARDIEKHTMVIEYIGTIIRNEVANRKEKLYESQNRGVYMFRMDNDHVIDATLTGGPARYINHSCAPNCVAEVVTFERGHKIIISSSRRIQKGEELCYDYKFDFEDDQHKIPCHCGAVNCRKWMN
Sequence Length
4911
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
547,633 Da
NCBI Official Full Name
histone-lysine N-methyltransferase 2C
NCBI Official Synonym Full Names
lysine methyltransferase 2C
NCBI Official Symbol
KMT2C
NCBI Official Synonym Symbols
HALR; MLL3; KLEFS2
NCBI Protein Information
histone-lysine N-methyltransferase 2C
UniProt Protein Name
Histone-lysine N-methyltransferase 2C
UniProt Gene Name
KMT2C
UniProt Synonym Gene Names
HALR; KIAA1506; MLL3; Lysine N-methyltransferase 2C

NCBI Description

This gene is a member of the myeloid/lymphoid or mixed-lineage leukemia (MLL) family and encodes a nuclear protein with an AT hook DNA-binding domain, a DHHC-type zinc finger, six PHD-type zinc fingers, a SET domain, a post-SET domain and a RING-type zinc finger. This protein is a member of the ASC-2/NCOA6 complex (ASCOM), which possesses histone methylation activity and is involved in transcriptional coactivation. [provided by RefSeq, Jul 2008]

Uniprot Description

Histone methyltransferase. Methylates 'Lys-4' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. Central component of the MLL2/3 complex, a coactivator complex of nuclear receptors, involved in transcriptional coactivation. KMT2C/MLL3 may be a catalytic subunit of this complex. May be involved in leukemogenesis and developmental disorder.

Research Articles on KMT2C

Similar Products

Product Notes

The KMT2C kmt2c (Catalog #AAA1387253) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 4689-4911. Fragment at the C-terminal. The amino acid sequence is listed below: FRYGRNPLME LPLAVNPTGC ARSEPKMSAH VKRFVLRPHT LNSTSTSKSF QSTVTGELNA PYSKQFVHSK SSQYRKMKTE WKSNVYLARS RIQGLGLYAA RDIEKHTMVI EYIGTIIRNE VANRKEKLYE SQNRGVYMFR MDNDHVIDAT LTGGPARYIN HSCAPNCVAE VVTFERGHKI IISSSRRIQK GEELCYDYKF DFEDDQHKIP CHCGAVNCRK WMN . It is sometimes possible for the material contained within the vial of "Histone-lysine N-methyltransferase MLL3 (MLL3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.