CD159a recombinant protein

CD159a Recombinant Protein

Cat. Num. AAA3004158

• Gene Names: KLRC1; NKG2; NKG2A; CD159A
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Synonyms: CD159a; CD159a Recombinant Protein; CD159a recombinant protein

• Host: E Coli
• Purity/Purification: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Form/Format: PBS, 4M Urea, PH7.4
• Concentration: >=0.5mg/ml (varies by lot)
• Sequence: PSTLIQRHNNSSLNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLSIISPSSWIGVFRNSSHHPWVTMNGLAFKHEIKDSDNAELNCAVLQVNRLKSAQCGSSIIYHCKHKL

• Tag: His-tag in C-terminal
• Expression Vector: pet-22b(+)
• BP: 432
• Restriction Site: NdeI-XhoI
• Preparation and Storage: Store at 4 degee C for short term. Aliquot and store at -20 degee C long term. Avoid freeze-thaw cycles.

Testing Data

()

Related Product Information for CD159a recombinant protein

Background: The activity of natural killer (NK) cells is regulated by members of multiple receptor families that recognize class I MHC molecules, such as the killer cell inhibitory receptor/leukocyte immunoglobulin-like receptor (KIR/LIR) family and the C-type lectin superfamily. The KIR/LIR family includes p91A (also designated pp130 or PIR-B, for paired immunoglobulin-like receptor-B) and p91B (also designated PIR-A). p91A acts as an inhibitory receptor through interactions with SHP-1, whereas p91B acts as an activating receptor. CD94, NKG2 and Ly-49 are members of the C-type lectin superfamily of type II membrane glycoproteins. CD94 forms heterodimers with NKG2 isoforms onthe surface of NK cells, whereas Ly-49 isoforms form homodimers. NKG2-D, expressed on NK cells, gdT cells and CD8+alphabeta T cells, is a receptor for the stress inducible protein MICA, an antigen frequently expressed in epithelial tumors.

NCBI and Uniprot Product Information

• NCBI GI #: 4504881
• NCBI GeneID: 3821
• NCBI Accession #: NP_002250.1
• NCBI GenBank Nucleotide #: NM_002259.4
• UniProt Accession #: P26715
• Molecular Weight: 26,314 Da
• NCBI Official Full Name: NKG2-A/NKG2-B type II integral membrane protein isoform NKG2-A
• NCBI Official Synonym Full Names: killer cell lectin-like receptor subfamily C, member 1
• NCBI Official Symbol: KLRC1
• NCBI Official Synonym Symbols: NKG2; NKG2A; CD159A
• NCBI Protein Information: NKG2-A/NKG2-B type II integral membrane protein; NK cell receptor A; C-lectin type II protein; natural killer cell lectin; natural killer group protein 2; NKG2-1/B activating NK receptor; NKG2-A/B-activating NK receptor; CD159 antigen-like family member A
• UniProt Protein Name: NKG2-A/NKG2-B type II integral membrane protein
• UniProt Gene Name: KLRC1
• UniProt Synonym Gene Names: NKG2A
• UniProt Entry Name: NKG2A_HUMAN

NCBI Description

Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. The protein encoded by this gene belongs to the killer cell lectin-like receptor family, also called NKG2 family, which is a group of transmembrane proteins preferentially expressed in NK cells. This family of proteins is characterized by the type II membrane orientation and the presence of a C-type lectin domain. This protein forms a complex with another family member, KLRD1/CD94, and has been implicated in the recognition of the MHC class I HLA-E molecules in NK cells. The genes of NKG2 family members form a killer cell lectin-like receptor gene cluster on chromosome 12. Four alternatively spliced transcript variants encoding two distinct isoforms have been observed. [provided by RefSeq, Jul 2008]

Uniprot Description

NKG2A: Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Receptor, misc.

Chromosomal Location of Human Ortholog: 12p13

Cellular Component: integral to plasma membrane; plasma membrane; receptor complex

Molecular Function: protein binding; transmembrane receptor activity; carbohydrate binding

Biological Process: regulation of immune response; cell surface receptor linked signal transduction