Plasma kallikrein (Klkb1) Recombinant Protein | Klkb1 recombinant protein

Recombinant Mouse Plasma kallikrein (Klkb1)

Cat. Num. AAA960857

• Gene Names: Klkb1; APS; PSA; Kal3; Klk3; Kal-3
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Plasma kallikrein (Klkb1); Recombinant Mouse Plasma kallikrein (Klkb1); Plasma kallikrein; EC=3.4.21.34; Fletcher factor; Kininogenin; Plasma prekallikreinCleaved into the following 2 chains:; 1. Plasma kallikrein heavy chain; 2. Plasma kallikrein light chain; Klkb1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 20-390, Full length protein
• Sequence: GCMTQLYKNTFFRGGDLAAIYTPDAQYCQKMCTFHPRCLLFSFLAVTPPKETNKRFGCFMKESITGTLPRIHRTGAISGHSLKQCGHQISACHRDIYKGLDMRGSNFNISKTDNIEECQKLCTNNFHCQFFTYATSAFYRPEYRKKCLLKHSASGTPTSIKSADNLVSGFSLKSCALSEIGCPMDIFQHSAFADLNVSQVITPDAFVCRTICTFHPNCLFFTFYTNEWETESQRNVCFLKTSKSGRPSPPIPQENAISGYSLLTCRKTRPEPCHSKIYSGVDFEGEELNVTFVQGADVCQETCTKTIRCQFFIYSLLPQDCKEEGCKCSLRLSTDGSPTRITYGMQGSSGYSLRLCKLVDSPDCTTKINAR
• Sequence Length: 371

• Species: Mus musculus (Mouse)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for Klkb1 recombinant protein

Abundant protease in the cytosolic granules of cytotoxic T-cells and NK-cells which activates caspase-independent cell death with morphological features of apoptosis when delivered into the target cell through the immunological synapse. It cleaves after Lys or Arg. Cleaves APEX1 after 'Lys-31' and destroys its oxidative repair activity. Cleaves the nucleosome assembly protein SET after 'Lys-189', which disrupts its nucleosome assembly activity and allows the SET complex to translocate into the nucleus to nick and degrade the DNA (By similarity).

Product Categories/Family for Klkb1 recombinant protein

Cell Biology

NCBI and Uniprot Product Information

• NCBI GI #: 236465805
• NCBI GeneID: 16621
• NCBI Accession #: NP_032481.2
• NCBI GenBank Nucleotide #: NM_008455.2
• UniProt Accession #: P26262; Q8R0P5
• Molecular Weight: 71,383 Da
• NCBI Official Full Name: plasma kallikrein
• NCBI Official Synonym Full Names: kallikrein B, plasma 1
• NCBI Official Symbol: Klkb1
• NCBI Official Synonym Symbols: APS; PSA; Kal3; Klk3; Kal-3
• NCBI Protein Information: plasma kallikrein; kininogenin; fletcher factor; kallikrein 3, plasma; plasma prekallikrein; antigen, prostate specific
• UniProt Protein Name: Plasma kallikrein
• Protein Family: Plasma kallikrein
• UniProt Gene Name: Klkb1
• UniProt Synonym Gene Names: Klk3; Pk
• UniProt Entry Name: KLKB1_MOUSE

NCBI Description

This gene encodes a member of the kallikrein subfamily of serine proteases that are involved in diverse physiological functions such as skin desquamation, tooth enamel formation, seminal liquefaction, synaptic neural plasticity and brain function. The encoded preproprotein undergoes proteolytic processing to generate a disulfide-linked heterodimeric enzyme comprised of heavy and light chains. A complete deletion of the encoded protein prevents occlusive thrombus formation in mice with a minimal role in provoked bleeding. [provided by RefSeq, May 2016]

Uniprot Description

KLKB1: The enzyme cleaves Lys-Arg and Arg-Ser bonds. It activates, in a reciprocal reaction, factor XII after its binding to a negatively charged surface. It also releases bradykinin from HMW kininogen and may also play a role in the renin-angiotensin system by converting prorenin into renin. Defects in KLKB1 are the cause of prekallikrein deficiency (PKK deficiency); also known as Fletcher factor deficiency. This disorder is a blood coagulation defect. Belongs to the peptidase S1 family. Plasma kallikrein subfamily.

Protein type: Protease; EC 3.4.21.34; Secreted; Secreted, signal peptide

Cellular Component: extracellular space; extracellular region

Molecular Function: peptidase activity; hydrolase activity; serine-type peptidase activity; serine-type endopeptidase activity; catalytic activity

Biological Process: fibrinolysis; hemostasis; positive regulation of fibrinolysis; blood coagulation; inflammatory response; proteolysis; plasminogen activation