Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page

Kallikrein-8 (Klk8) Recombinant Protein | Klk8 recombinant protein

Recombinant Mouse Kallikrein-8 (Klk8)

Gene Names
Klk8; BSP1; Nrpn; Prss19
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Kallikrein-8 (Klk8); Recombinant Mouse Kallikrein-8 (Klk8); Kallikrein-8; mK8; EC=3.4.21.118; Neuropsin; NP; Serine protease 19; Klk8 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
33-260aa; Full Length of Mature Protein
Sequence
ILEGRECIPHSQPWQAALFQGERLICGGVLVGDRWVLTAAHCKKQKYSVRLGDHSLQSRDQPEQEIQVAQSIQHPCYNNSNPEDHSHDIMLIRLQNSANLGDKVKPVQLANLCPKVGQKCIISGWGTVTSPQENFPNTLNCAEVKIYSQNKCERAYPGKITEGMVCAGSSNGADTCQGDSGGPLVCDGMLQGITSWGSDPCGKPEKPGVYTKICRYTTWIKKTMDNRD
Sequence Length
228
Species
Mus musculus (Mouse)
Production Note
Special Offer: The E Coli, Yeast host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Coli, Yeasthost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli, Yeast host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli, Yeast host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-Page

SDS-Page
Related Product Information for Klk8 recombinant protein
Serine protease which is capable of degrading a number of proteins such as casein, fibrinogen, kininogen, fibronectin and collagen type IV. Also cleaves L1CAM in response to increased neural activity. Induces neurite outgrowth and fasciculation of cultured hippocampal neurons. Plays a role in the formation and maturation of orphan and small synaptic boutons in the Schaffer-collateral pathway, regulates Schaffer-collateral long-term potentiation in the hippocampus and is required for memory acquisition and synaptic plasticity. Involved in skin desquamation and keratinocyte proliferation. Plays a role in the secondary phase of pathogenesis following spinal cord injury.
Product Categories/Family for Klk8 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27.1 kDa
NCBI Official Full Name
kallikrein-8
NCBI Official Synonym Full Names
kallikrein related-peptidase 8
NCBI Official Symbol
Klk8
NCBI Official Synonym Symbols
BSP1; Nrpn; Prss19
NCBI Protein Information
kallikrein-8; NP; mK8; neuropsin; kallikrein 8; serine protease 19; Brain Serine protease 1; protease, serine, 19 (neuropsin)
UniProt Protein Name
Kallikrein-8
Protein Family
UniProt Gene Name
Klk8
UniProt Synonym Gene Names
Nrpn; Prss19; mK8; NP
UniProt Entry Name
KLK8_MOUSE

Uniprot Description

KLK8: Serine protease which is capable of degrading a number of proteins such as casein, fibrinogen, kininogen, fibronectin and collagen type IV. Also cleaves L1CAM in response to increased neural activity. Induces neurite outgrowth and fasciculation of cultured hippocampal neurons. Plays a role in the formation and maturation of orphan and small synaptic boutons in the Schaffer- collateral pathway, regulates Schaffer-collateral long-term potentiation in the hippocampus and is required for memory acquisition and synaptic plasticity. Involved in skin desquamation and keratinocyte proliferation. Plays a role in the secondary phase of pathogenesis following spinal cord injury. Belongs to the peptidase S1 family. Kallikrein subfamily. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Protease; EC 3.4.21.118; Secreted; Cell development/differentiation; Secreted, signal peptide

Cellular Component: extracellular space; cytoplasm; extracellular region

Molecular Function: peptidase activity; hydrolase activity; serine-type peptidase activity; serine-type endopeptidase activity; catalytic activity

Biological Process: cell death; negative regulation of myelination; negative regulation of axon regeneration; response to wounding; synapse organization and biogenesis; regulation of synapse organization and biogenesis; keratinocyte proliferation; proteolysis; neurite morphogenesis; memory

Research Articles on Klk8

Similar Products

Product Notes

The Klk8 klk8 (Catalog #AAA1436257) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 33-260aa; Full Length of Mature Protein. The amino acid sequence is listed below: ILEGRECIPH SQPWQAALFQ GERLICGGVL VGDRWVLTAA HCKKQKYSVR LGDHSLQSRD QPEQEIQVAQ SIQHPCYNNS NPEDHSHDIM LIRLQNSANL GDKVKPVQLA NLCPKVGQKC IISGWGTVTS PQENFPNTLN CAEVKIYSQN KCERAYPGKI TEGMVCAGSS NGADTCQGDS GGPLVCDGML QGITSWGSDP CGKPEKPGVY TKICRYTTWI KKTMDNRD. It is sometimes possible for the material contained within the vial of "Kallikrein-8 (Klk8), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.