Kit ligand Recombinant Protein | KITLG recombinant protein

Recombinant Human Kit ligand

Cat. Num. AAA961597

• Gene Names: KITLG; SF; MGF; SCF; DCUA; FPH2; FPHH; KL-1; Kitl; SHEP7
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Kit ligand; Recombinant Human Kit ligand; Mast cell growth factor; MGFStem cell factor; SCFc-Kit ligand; KITLG recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 26-189aa; Partial
• Sequence: EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA
• Sequence Length: 273

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for KITLG recombinant protein

Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hatopoiesis, st cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins.

Product Categories/Family for KITLG recombinant protein

Developmental Biology

References

Primary structure and functional expression of rat and human stem cell factor DNAs.Martin F.H., Suggs S.V., Langley K.E., Lu H.S., Ting J., Okino K.H., Morris C.F., McNiece I.K., Jacobsen F.W., Mendiaz E.A., Birkett N.C., Smith K.A., Johnson M.J., Parker V.P., Flores J.C., Patel A.C., Fisher E.F., Erjavec H.O., Herrera C.J., Wypych J., Sachdev R.K., Pope J.A., Leslie I., Wen D., Lin C.-H., Cupples R.L., Zsebo K.M.Cell 63:203-211(1990) Alternate splicing of mRNAs encoding human mast cell growth factor and localization of the gene to chromosome 12q22-q24.Anderson D.M., Williams D.E., Tushinski R., Gimpel S., Eisenman J., Cannizzaro L.A., Aronson M., Croce C.M., Huebner K., Cosman D.Cell Growth Differ. 2:373-378(1991) Parathyroid hormone-regulated production of stem cell factor in human osteoblasts and osteoblast-like cells.Blair H.C., Julian B.A., Cao X., Jordan S.E., Dong S.S.Biochem. Biophys. Res. Commun. 255:778-784(1999) Han C., Peng X., Yuan J., Qiang B.Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) The full-ORF clone resource of the German cDNA consortium.Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.BMC Genomics 8:399-399(2007)

NCBI and Uniprot Product Information

• NCBI GI #: 4505175
• NCBI GeneID: 4254
• NCBI Accession #: NP_000890.1
• NCBI GenBank Nucleotide #: NM_000899.4
• UniProt Accession #: P21583; Q16487; Q68DZ2; Q7M4N8; Q9UQK7; A0AV09; A8K2Q4; B7ZLM4
• Molecular Weight: 45.5 kDa
• NCBI Official Full Name: kit ligand isoform b
• NCBI Official Synonym Full Names: KIT ligand
• NCBI Official Symbol: KITLG
• NCBI Official Synonym Symbols: SF; MGF; SCF; DCUA; FPH2; FPHH; KL-1; Kitl; SHEP7
• NCBI Protein Information: kit ligand
• UniProt Protein Name: Kit ligand
• Protein Family: Kit ligand
• UniProt Gene Name: KITLG
• UniProt Synonym Gene Names: MGF; SCF; MGF; SCF; sKITLG
• UniProt Entry Name: SCF_HUMAN

NCBI Description

This gene encodes the ligand of the tyrosine-kinase receptor encoded by the KIT locus. This ligand is a pleiotropic factor that acts in utero in germ cell and neural cell development, and hematopoiesis, all believed to reflect a role in cell migration. In adults, it functions pleiotropically, while mostly noted for its continued requirement in hematopoiesis. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

SCF: Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5- trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins. Homodimer, non-covalently linked (Probable). Heterotetramer with KIT, binding two KIT molecules; thereby mediates KIT dimerization and subsequent activation by autophosphorylation. Belongs to the SCF family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 12q22

Cellular Component: cytoplasm; cytoskeleton; extracellular region; extracellular space; integral to membrane; plasma membrane

Molecular Function: cytokine activity; growth factor activity; protein binding; stem cell factor receptor binding

Biological Process: activation of MAPKK activity; axon guidance; cell adhesion; cell proliferation; embryonic hemopoiesis; epidermal growth factor receptor signaling pathway; fibroblast growth factor receptor signaling pathway; germ cell programmed cell death; innate immune response; insulin receptor signaling pathway; male gonad development; MAPKKK cascade; negative regulation of mast cell apoptosis; nerve growth factor receptor signaling pathway; neural crest cell migration; ovarian follicle development; phosphoinositide-mediated signaling; positive regulation of DNA replication; positive regulation of leukocyte migration; positive regulation of MAP kinase activity; positive regulation of melanocyte differentiation; positive regulation of myeloid leukocyte differentiation; positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of Ras protein signal transduction; Ras protein signal transduction; signal transduction; small GTPase mediated signal transduction; vascular endothelial growth factor receptor signaling pathway

Disease: Hyperpigmentation, Familial Progressive, 2; Skin/hair/eye Pigmentation, Variation In, 7