Kit ligand (KITLG) Recombinant Protein | KITLG recombinant protein

Recombinant Human Kit ligand (KITLG), partial

Cat. Num. AAA7135739

• Gene Names: KITLG; SF; MGF; SCF; SLF; DCUA; FPH2; FPHH; KL-1; Kitl; SHEP7; DFNA69
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Kit ligand (KITLG); Recombinant Human Kit ligand (KITLG); partial; Kit ligand (Mast cell growth factor); (Stem cell factor); (c-Kit ligand; (MGF); (SCF); KITLG recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid or Lyophilized powder; If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.; If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, p
• Sequence Positions: 26-189aa; Partial
• Sequence: EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA
• Sequence Length: 273

• Species: Human
• Tag: C-terminal FC-Myc-tagged
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Preparation and Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. ; Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C.; The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.; Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for KITLG recombinant protein

Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins.

Product Categories/Family for KITLG recombinant protein

Developmental Biology

References

"Parathyroid hormone-regulated production of stem cell factor in human osteoblasts and osteoblast-like cells."
Blair H.C., Julian B.A., Cao X., Jordan S.E., Dong S.S.Biochem. Biophys. Res. Commun. 255:778-784(1999)

NCBI and Uniprot Product Information

• NCBI GI #: 4505175
• NCBI GeneID: 4254
• NCBI Accession #: NP_000890.1
• NCBI GenBank Nucleotide #: NP_000890.1
• UniProt Accession #: P21583
• Molecular Weight: 48.6
• NCBI Official Full Name: kit ligand isoform b
• NCBI Official Synonym Full Names: KIT ligand
• NCBI Official Symbol: KITLG
• NCBI Official Synonym Symbols: SF; MGF; SCF; SLF; DCUA; FPH2; FPHH; KL-1; Kitl; SHEP7; DFNA69
• NCBI Protein Information: kit ligand
• UniProt Protein Name: Kit ligand
• Protein Family: Kit ligand
• UniProt Gene Name: KITLG
• UniProt Synonym Gene Names: MGF; SCF; MGF; SCF; sKITLG
• UniProt Entry Name: SCF_HUMAN

NCBI Description

This gene encodes the ligand of the tyrosine-kinase receptor encoded by the KIT locus. This ligand is a pleiotropic factor that acts in utero in germ cell and neural cell development, and hematopoiesis, all believed to reflect a role in cell migration. In adults, it functions pleiotropically, while mostly noted for its continued requirement in hematopoiesis. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]