Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Killer cell immunoglobulin-like receptor 3DL2 (KIR3DL2) Recombinant Protein | KIR3DL2 recombinant protein

Recombinant Human Killer cell immunoglobulin-like receptor 3DL2 (KIR3DL2)

Gene Names
KIR3DL2; p140; NKAT4; CD158K; NKAT-4; NKAT4B
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Killer cell immunoglobulin-like receptor 3DL2 (KIR3DL2); Recombinant Human Killer cell immunoglobulin-like receptor 3DL2 (KIR3DL2); Killer cell immunoglobulin-like receptor 3DL2; CD158 antigen-like family member K; MHC class I NK cell receptor; Natural killer-associated transcript 4; NKAT-4; p70 natural killer cell receptor clone CL-5; p70 NK receptor CL-5; CD_antigen=; CD158k; KIR3DL2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
22-340. Fragment at the N-terminal, provide the complete extracellular domain
Sequence
LMGGQDKPFLSARPSTVVPRGGHVALQCHYRRGFNNFMLYKEDRSHVPIFHGRIFQESFIMGPVTPAHAGTYRCRGSRPHSLTGWSAPSNPLVIMVTGNHRKPSLLAHPGPLLKSGETVILQCWSDVMFEHFFLHREGISEDPSRLVGQIHDGVSKANFSIGPLMPVLAGTYRCYGSVPHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVQAGENVTLSCSSWSSYDIYHLSREGEAHERRLRAVPKVNRTFQADFPLGPATHGGTYRCFGSFRALPCVWSNSSDPLLVSVTGNPSSSWPSPTEPSSKSGICRHLH
Sequence Length
340
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,517 Da
NCBI Official Full Name
killer cell immunoglobulin-like receptor 3DL2 isoform 2
NCBI Official Synonym Full Names
killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 2
NCBI Official Symbol
KIR3DL2
NCBI Official Synonym Symbols
p140; NKAT4; CD158K; NKAT-4; NKAT4B
NCBI Protein Information
killer cell immunoglobulin-like receptor 3DL2; KIR antigen 3DL2; killer Ig receptor; p70 NK receptor CL-5; MHC class I NK cell receptor; CD158 antigen-like family member K; p70 killer cell inhibitory receptor; natural killer-associated transcript 4; p70 natural killer cell receptor clone CL-5
UniProt Protein Name
Killer cell immunoglobulin-like receptor 3DL2
UniProt Gene Name
KIR3DL2
UniProt Synonym Gene Names
CD158K; NKAT4; NKAT-4; p70 NK receptor CL-5
UniProt Entry Name
KI3L2_HUMAN

NCBI Description

Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the 1 Mb leukocyte receptor complex (LRC). The gene content of the KIR gene cluster varies among haplotypes, although several "framework" genes are found in all haplotypes (KIR3DL3, KIR3DP1, KIR3DL4, KIR3DL2). The KIR proteins are classified by the number of extracellular immunoglobulin domains (2D or 3D) and by whether they have a long (L) or short (S) cytoplasmic domain. KIR proteins with the long cytoplasmic domain transduce inhibitory signals upon ligand binding via an immune tyrosine-based inhibitory motif (ITIM), while KIR proteins with the short cytoplasmic domain lack the ITIM motif and instead associate with the TYRO protein tyrosine kinase binding protein to transduce activating signals. The ligands for several KIR proteins are subsets of HLA class I molecules; thus, KIR proteins are thought to play an important role in regulation of the immune response. This gene is one of the "framework" loci that is present on all haplotypes. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jun 2011]

Uniprot Description

KIR3DL2: Receptor on natural killer (NK) cells for HLA-A alleles. Inhibits the activity of NK cells thus preventing cell lysis. Belongs to the immunoglobulin superfamily.

Protein type: Membrane protein, integral; Receptor, misc.

Chromosomal Location of Human Ortholog: 19q13.4

Cellular Component: integral to plasma membrane; plasma membrane

Biological Process: regulation of immune response; cellular defense response

Research Articles on KIR3DL2

Similar Products

Product Notes

The KIR3DL2 kir3dl2 (Catalog #AAA717688) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-340. Fragment at the N-terminal, provide the complete extracellular domain. The amino acid sequence is listed below: LMGGQDKPFL SARPSTVVPR GGHVALQCHY RRGFNNFMLY KEDRSHVPIF HGRIFQESFI MGPVTPAHAG TYRCRGSRPH SLTGWSAPSN PLVIMVTGNH RKPSLLAHPG PLLKSGETVI LQCWSDVMFE HFFLHREGIS EDPSRLVGQI HDGVSKANFS IGPLMPVLAG TYRCYGSVPH SPYQLSAPSD PLDIVITGLY EKPSLSAQPG PTVQAGENVT LSCSSWSSYD IYHLSREGEA HERRLRAVPK VNRTFQADFP LGPATHGGTY RCFGSFRALP CVWSNSSDPL LVSVTGNPSS SWPSPTEPSS KSGICRHLH . It is sometimes possible for the material contained within the vial of "Killer cell immunoglobulin-like receptor 3DL2 (KIR3DL2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.