CD158a recombinant protein

CD158a Recombinant Protein

Cat. Num. AAA3004106

• Gene Names: KIR2DL1; NKAT; NKAT1; p58.1; CD158A; KIR221; NKAT-1; KIR-K64
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Synonyms: CD158a; CD158a Recombinant Protein; CD158a recombinant protein

• Host: E Coli
• Purity/Purification: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Form/Format: PBS, 4M Urea, PH7.4
• Concentration: >=0.5mg/ml (varies by lot)
• Sequence: HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMTQDLAGTYRCYGSVTHSPYQVSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGPKVNGTFQADFPLGPATHGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLH

• Tag: His-tag in C-terminal
• Expression Vector: pet-22b(+)
• BP: 684
• Restriction Site: NdeI-XhoI
• Preparation and Storage: Store at 4 degee C for short term. Aliquot and store at -20 degee C long term. Avoid freeze-thaw cycles.

Testing Data

()

Related Product Information for CD158a recombinant protein

Background: NKAT (NK-associated transcripts) gene products, known as killer immunoglobulin-like receptors or KIRs, downregulate the cytotoxicity of NK cells upon recognition of specific class I major histocompatibility complex (MHC) molecules on target cells. This family of receptors is characterized by an extracellular region with two to three immunoglobulin-superfamily domains and a cytoplasmic domain with an antigen receptor activation motif (ARAM). KIRs and other inhibitory receptors also possess a common cytoplasmic sequence (I/VxYxxL/V) known as an ITIM (immunoreceptor tyrosine-based inhibitory motif). The human inhibitory natural killer cell immunoglobulin-likereceptor 2DL1, also designated KIR2DL1, CL-42, NKAT1, P58.1 or CD158a long form, is a 348 amino acid type I transmembrane protein. KIR2DL1 can bind human leukocyte antigen-C (HLA-C) via both polar and hydrophobic interactions through Met 44 in a binding pocket that coordinates Lys 80 of HLA-C.

NCBI and Uniprot Product Information

• NCBI GI #: 1171726
• NCBI GeneID: 3802
• UniProt Accession #: P43626; O43470; Q32WE6; Q6IST4
• Molecular Weight: 348
• NCBI Official Full Name: Killer cell immunoglobulin-like receptor 2DL1
• NCBI Official Synonym Full Names: killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1
• NCBI Official Symbol: KIR2DL1
• NCBI Official Synonym Symbols: NKAT; NKAT1; p58.1; CD158A; KIR221; NKAT-1; KIR-K64
• NCBI Protein Information: killer cell immunoglobulin-like receptor 2DL1; killer Ig receptor; p58 NK receptor CL-42/47.11; MHC class I NK cell receptor; killer inhibitory receptor 2-2-1; CD158 antigen-like family member A; natural killer-associated transcript 1; p58 NK cell inhibit
• UniProt Protein Name: Killer cell immunoglobulin-like receptor 2DL1
• UniProt Gene Name: KIR2DL1
• UniProt Synonym Gene Names: CD158A; NKAT1; NKAT-1; p58 NK receptor CL-42/47.11
• UniProt Entry Name: KI2L1_HUMAN

NCBI Description

Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the 1 Mb leukocyte receptor complex (LRC). The gene content of the KIR gene cluster varies among haplotypes, although several "framework" genes are found in all haplotypes (KIR3DL3, KIR3DP1, KIR3DL4, KIR3DL2). The KIR proteins are classified by the number of extracellular immunoglobulin domains (2D or 3D) and by whether they have a long (L) or short (S) cytoplasmic domain. KIR proteins with the long cytoplasmic domain transduce inhibitory signals upon ligand binding via an immune tyrosine-based inhibitory motif (ITIM), while KIR proteins with the short cytoplasmic domain lack the ITIM motif and instead associate with the TYRO protein tyrosine kinase binding protein to transduce activating signals. The ligands for several KIR proteins are subsets of HLA class I molecules; thus, KIR proteins are thought to play an important role in regulation of the immune response. [provided by RefSeq, Jul 2008]

Uniprot Description

KIR2DL1: Receptor on natural killer (NK) cells for HLA-C alleles. Inhibits the activity of NK cells thus preventing cell lysis. Interacts with ARRB2. Interacts with PTPN6; the interaction is enhanced by ARRB2. Interacts with PTPN11; the interaction is enhanced by ARRB2. Belongs to the immunoglobulin superfamily.

Protein type: Receptor, misc.; Membrane protein, integral

Chromosomal Location of Human Ortholog: 19q13.4

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: protein binding; receptor activity

Biological Process: regulation of immune response; natural killer cell inhibitory signaling pathway; immune response