Alginate biosynthesis sensor protein kinB (kinB) Recombinant Protein | kinB recombinant protein
Recombinant Alginate biosynthesis sensor protein kinB (kinB)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Alginate biosynthesis sensor protein kinB (kinB); Recombinant Alginate biosynthesis sensor protein kinB (kinB); kinB recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-595aa; full length protein
Sequence
MSMPLPMKLRTRLFLSISALITVSLFGLLLGLFSVMQLGRAQEQRMSHHYATIEVSQQLR QLLGDQLVILLRETPDGQALERSQNDFRRVLEQGRANTVDSAEQAALDGVRDAYLQLQAH TPALLEAPMVDNDGFSEAFNGLRLRLQDLQQLALAGISDAETSARHRAYLVAGLLGLVGV AILLIGFVTAHSIARRFGAPIETLARAADRIGEGDFDVTLPMTNVAEVGQLTRRFGLMAE ALRQYRKTSVEEVLSGERRLQAVLDSIDDGLVIFDNQGRIEHANPVAIRQLFVSNDPHGK RIDEILSDVDVQEAVEKALLGEVQDEAMPDLVVDVAGESRLLAWSLYPVTHPGGHSVGAV LVVRDVTEQRAFERVRSEFVLRASHELRTPVTGMQMAFSLLRERLDFPAESREADLIQTV DEEMSRLVLLINDLLNFSRYQTGMQKLELASCDLVDLLTQAQQRFIPKGEARRVSLQLEL GDELPRLQLDRLQIERVIDNLLENALRHSSEGGQIHLQARRQGDRVLIAVEDNGEGIPFS QQGRIFEPFVQVGRKKGGAGLGLELCKEIIQLHGGRIAVRSQPGQGARFYMLLPV
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Pseudomonas aeruginosa
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for kinB recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
UniProt Accession #
Molecular Weight
66,072 Da
NCBI Official Full Name
Alginate biosynthesis sensor protein KinB
UniProt Protein Name
Alginate biosynthesis sensor protein KinB
Protein Family
UniProt Gene Name
kinB
UniProt Entry Name
KINB_PSEAI
Uniprot Description
Member of the two-component regulatory system AlgB/KinB involved in regulation of alginate biosynthesis genes. KinB functions as a membrane-associated protein kinase that phosphorylates AlgB, probably in response to environmental signals.
Similar Products
Product Notes
The kinB kinb (Catalog #AAA7018117) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-595aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the kinB kinb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSMPLPMKLR TRLFLSISAL ITVSLFGLLL GLFSVMQLGR AQEQRMSHHY ATIEVSQQLR QLLGDQLVIL LRETPDGQAL ERSQNDFRRV LEQGRANTVD SAEQAALDGV RDAYLQLQAH TPALLEAPMV DNDGFSEAFN GLRLRLQDLQ QLALAGISDA ETSARHRAYL VAGLLGLVGV AILLIGFVTA HSIARRFGAP IETLARAADR IGEGDFDVTL PMTNVAEVGQ LTRRFGLMAE ALRQYRKTSV EEVLSGERRL QAVLDSIDDG LVIFDNQGRI EHANPVAIRQ LFVSNDPHGK RIDEILSDVD VQEAVEKALL GEVQDEAMPD LVVDVAGESR LLAWSLYPVT HPGGHSVGAV LVVRDVTEQR AFERVRSEFV LRASHELRTP VTGMQMAFSL LRERLDFPAE SREADLIQTV DEEMSRLVLL INDLLNFSRY QTGMQKLELA SCDLVDLLTQ AQQRFIPKGE ARRVSLQLEL GDELPRLQLD RLQIERVIDN LLENALRHSS EGGQIHLQAR RQGDRVLIAV EDNGEGIPFS QQGRIFEPFV QVGRKKGGAG LGLELCKEII QLHGGRIAVR SQPGQGARFY MLLPV. It is sometimes possible for the material contained within the vial of "Alginate biosynthesis sensor protein kinB (kinB), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
