Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Potassium channel subfamily K member 1 (KCNK1) Recombinant Protein | KCNK1 recombinant protein

Recombinant Human Potassium channel subfamily K member 1 (KCNK1)

Gene Names
KCNK1; DPK; HOHO; K2P1; KCNO1; TWIK1; K2p1.1; TWIK-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Potassium channel subfamily K member 1 (KCNK1); Recombinant Human Potassium channel subfamily K member 1 (KCNK1); KCNK1 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-336aa; Full length protein
Sequence
MLQSLAGSSCVRLVERHRSAWCFGFLVLGYLLYLVFGAVVFSSVELPYEDLLRQELRKLK RRFLEEHECLSEQQLEQFLGRVLEASNYGVSVLSNASGNWNWDFTSALFFASTVLSTTGY GHTVPLSDGGKAFCIIYSVIGIPFTLLFLTAVVQRITVHVTRRPVLYFHIRWGFSKQVVA IVHAVLLGFVTVSCFFFIPAAVFSVLEDDWNFLESFYFCFISLSTIGLGDYVPGEGYNQK FRELYKIGITCYLLLGLIAMLVVLETFCELHELKKFRKMFYVKKDKDEDQVHIIEHDQLS FSSITDQAAGMKEDQKQNEPFVATQSSACVDGPANH
Sequence Length
336
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for KCNK1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38,143 Da
NCBI Official Full Name
potassium channel subfamily K member 1
NCBI Official Synonym Full Names
potassium two pore domain channel subfamily K member 1
NCBI Official Symbol
KCNK1
NCBI Official Synonym Symbols
DPK; HOHO; K2P1; KCNO1; TWIK1; K2p1.1; TWIK-1
NCBI Protein Information
potassium channel subfamily K member 1
UniProt Protein Name
Potassium channel subfamily K member 1
UniProt Gene Name
KCNK1
UniProt Entry Name
KCNK1_HUMAN

NCBI Description

This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The product of this gene has not been shown to be a functional channel, however, it may require other non-pore-forming proteins for activity. [provided by RefSeq, Jul 2008]

Uniprot Description

KCNK1: Weakly inward rectifying potassium channel. Homodimer (Potential). Widely expressed with high levels in heart and brain and lower levels in placenta, lung, liver and kidney. Belongs to the two pore domain potassium channel (TC 1.A.1.8) family.

Protein type: Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q42-q43

Cellular Component: apical plasma membrane; brush border membrane; cell junction; cytoplasmic membrane-bound vesicle; dendrite; integral to membrane; integral to plasma membrane; perikaryon; plasma membrane; recycling endosome; synapse; voltage-gated potassium channel complex

Molecular Function: inward rectifier potassium channel activity; potassium channel activity; potassium ion leak channel activity; sodium channel activity; voltage-gated potassium channel activity

Biological Process: potassium ion transport; regulation of resting membrane potential; response to nicotine; stabilization of membrane potential

Research Articles on KCNK1

Similar Products

Product Notes

The KCNK1 kcnk1 (Catalog #AAA7017724) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-336aa; Full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the KCNK1 kcnk1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MLQSLAGSSC VRLVERHRSA WCFGFLVLGY LLYLVFGAVV FSSVELPYED LLRQELRKLK RRFLEEHECL SEQQLEQFLG RVLEASNYGV SVLSNASGNW NWDFTSALFF ASTVLSTTGY GHTVPLSDGG KAFCIIYSVI GIPFTLLFLT AVVQRITVHV TRRPVLYFHI RWGFSKQVVA IVHAVLLGFV TVSCFFFIPA AVFSVLEDDW NFLESFYFCF ISLSTIGLGD YVPGEGYNQK FRELYKIGIT CYLLLGLIAM LVVLETFCEL HELKKFRKMF YVKKDKDEDQ VHIIEHDQLS FSSITDQAAG MKEDQKQNEP FVATQSSACV DGPANH. It is sometimes possible for the material contained within the vial of "Potassium channel subfamily K member 1 (KCNK1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.