G protein-activated inward rectifier potassium channel 2 (KCNJ6) Recombinant Protein | KCNJ6 recombinant protein
Recombinant Mesocricetus auratus G protein-activated inward rectifier potassium channel 2 (KCNJ6)
Gene Names
Kcnj6; GIRK2; KATP2; KCNJ7; GIRK-2; KATP-2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
G protein-activated inward rectifier potassium channel 2 (KCNJ6); Recombinant Mesocricetus auratus G protein-activated inward rectifier potassium channel 2 (KCNJ6); KCNJ6 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-425aa; full length protein
Sequence
MTMAKLTESMTNVLEGDSMDQDVESPVAIHQPKLPKQARDDLPRHISRDRTKRKIQRYVR KDGKCNVHHGNVRETYRYLTDILTTLVDLKWRFNLLIFVMVYTVTWLFFGMIWWLIAYIR GDMDHVEDPSWTPCVTNLNGFVSAFLFSIETETTIGYGYRVITDKCPEGIILLLIQSVLG SIVNAFMVGCMFVKISQPKKRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIR AKLIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLP KEELEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVLTLEDGFYEVDYNSFHETY ETSTPSLSAKELAELANRAELPLSWSVSSKLNQHAELETEEEEKNPEEQTERNGDVANLE NESKV
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mesocricetus auratus (Golden hamster)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for KCNJ6 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,647 Da
NCBI Official Full Name
G protein-activated inward rectifier potassium channel 2
NCBI Official Symbol
Kcnj6
NCBI Official Synonym Symbols
GIRK2; KATP2; KCNJ7; GIRK-2; KATP-2
NCBI Protein Information
G protein-activated inward rectifier potassium channel 2
UniProt Protein Name
G protein-activated inward rectifier potassium channel 2
Protein Family
UniProt Gene Name
KCNJ6
UniProt Synonym Gene Names
GIRK2; KATP2; KCNJ7; GIRK-2
UniProt Entry Name
KCNJ6_MESAU
Uniprot Description
This potassium channel may be involved in the regulation of insulin secretion by glucose and/or neurotransmitters acting through G-protein-coupled receptors. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium.
Similar Products
Product Notes
The KCNJ6 kcnj6 (Catalog #AAA7017712) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-425aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the KCNJ6 kcnj6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MTMAKLTESM TNVLEGDSMD QDVESPVAIH QPKLPKQARD DLPRHISRDR TKRKIQRYVR KDGKCNVHHG NVRETYRYLT DILTTLVDLK WRFNLLIFVM VYTVTWLFFG MIWWLIAYIR GDMDHVEDPS WTPCVTNLNG FVSAFLFSIE TETTIGYGYR VITDKCPEGI ILLLIQSVLG SIVNAFMVGC MFVKISQPKK RAETLVFSTH AVISMRDGKL CLMFRVGDLR NSHIVEASIR AKLIKSKQTS EGEFIPLNQT DINVGYYTGD DRLFLVSPLI ISHEINQQSP FWEISKAQLP KEELEIVVIL EGMVEATGMT CQARSSYITS EILWGYRFTP VLTLEDGFYE VDYNSFHETY ETSTPSLSAK ELAELANRAE LPLSWSVSSK LNQHAELETE EEEKNPEEQT ERNGDVANLE NESKV. It is sometimes possible for the material contained within the vial of "G protein-activated inward rectifier potassium channel 2 (KCNJ6), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
