Inward rectifier potassium channel 2 (KCNJ2) Recombinant Protein | KCNJ2 recombinant protein

Recombinant Macaca mulatta (Rhesus macaque) Inward rectifier potassium channel 2 (KCNJ2)

Gene Names

KCNJ2; IRK1

Purity

Greater or equal to 85% purity as determined by SDS-PAGE.

Synonyms

Inward rectifier potassium channel 2 (KCNJ2); Recombinant Macaca mulatta (Rhesus macaque) Inward rectifier potassium channel 2 (KCNJ2); KCNJ2 recombinant protein

Ordering
Cat. Num. AAA7017694 When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures. For Research Use Only!

Host

Cell Free Expression

Purity/Purification

Greater or equal to 85% purity as determined by SDS-PAGE.

Form/Format

Liquid containing glycerol

Sequence Positions

1-427aa; Full length protein

Sequence

MGSVRTNRYSIVSSEEDGMKLATMAVANGFGNGKSKVHTRQQCRSRFVKKDGHCNVQFIN VGEKGQRYLADIFTTCVDIRWRWMLVIFCLAFVLSWLFFGCVFWLIALLHGDLDASKEGK ACVSEVNSFTAAFLFSIETQTTIGYGFRCVTDECPIAVFMVVFQSIVGCIIDAFIIGAVM AKMAKPKKRNETLVFSHNAVIAMRDGKLCLMWRVGNLRKSHLVEAHVRAQLLKSRITSEG EYIPLDQIDINVGFDSGIDRIFLVSPITIVHEIDEDSPLYDLSKQDIDNADFEIVVILEG MVEATAMTTQCRSSYLANEILWGHRYEPVLFEEKHYYKVDYSRFHKTYEVPNTPLCSARD LAEKKYILSNANSFCYENEVALTSKEEDDSENGVPESTSTDTPPDIDLHNQASVPLEPRP LRRESEI

Sequence Length

Full length protein

Application Notes

This is a recombinant transmembrane protein expressed in a cell-free expression system.

Species

Macaca mulatta (Rhesus macaque)

Preparation and Storage

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Product Categories/Family for KCNJ2 recombinant protein

Transmembrane Protein

NCBI and Uniprot Product Information

NCBI GI #

74136279

NCBI GeneID

574189

NCBI Accession #

NP_001028031.1

NCBI GenBank Nucleotide #

NM_001032859.1

UniProt Accession #

P63253; O15110; P48049

Molecular Weight

48,288 Da

NCBI Official Full Name

inward rectifier potassium channel 2

NCBI Official Symbol

KCNJ2

NCBI Official Synonym Symbols

IRK1

NCBI Protein Information

inward rectifier potassium channel 2

UniProt Protein Name

Inward rectifier potassium channel 2

Protein Family

Inward rectifier potassium channel

UniProt Gene Name

KCNJ2

UniProt Synonym Gene Names

IRK1; IRK-1

UniProt Entry Name

KCNJ2_MACMU

Uniprot Description

Probably participates in establishing action potential waveform and excitability of neuronal and muscle tissues. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by extracellular barium or cesium.

Similar Products

KCNJ2 ELISA Kit

Host: n/a

Reactivity: Mouse

Apps: n/a

Product Notes

The KCNJ2 kcnj2 (Catalog #AAA7017694) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-427aa; Full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the KCNJ2 kcnj2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGSVRTNRYS IVSSEEDGMK LATMAVANGF GNGKSKVHTR QQCRSRFVKK DGHCNVQFIN VGEKGQRYLA DIFTTCVDIR WRWMLVIFCL AFVLSWLFFG CVFWLIALLH GDLDASKEGK ACVSEVNSFT AAFLFSIETQ TTIGYGFRCV TDECPIAVFM VVFQSIVGCI IDAFIIGAVM AKMAKPKKRN ETLVFSHNAV IAMRDGKLCL MWRVGNLRKS HLVEAHVRAQ LLKSRITSEG EYIPLDQIDI NVGFDSGIDR IFLVSPITIV HEIDEDSPLY DLSKQDIDNA DFEIVVILEG MVEATAMTTQ CRSSYLANEI LWGHRYEPVL FEEKHYYKVD YSRFHKTYEV PNTPLCSARD LAEKKYILSN ANSFCYENEV ALTSKEEDDS ENGVPESTST DTPPDIDLHN QASVPLEPRP LRRESEI. It is sometimes possible for the material contained within the vial of "Inward rectifier potassium channel 2 (KCNJ2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Loading...