Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ATP-sensitive inward rectifier potassium channel 14 (Kcnj14) Recombinant Protein | Kcnj14 recombinant protein

Recombinant Rat ATP-sensitive inward rectifier potassium channel 14 (Kcnj14)

Gene Names
Kcnj14; Kir2.4
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ATP-sensitive inward rectifier potassium channel 14 (Kcnj14); Recombinant Rat ATP-sensitive inward rectifier potassium channel 14 (Kcnj14); Recombinant ATP-sensitive inward rectifier potassium channel 14 (Kcnj14); ATP-sensitive inward rectifier potassium channel 14; Inward rectifier K(+) channel Kir2.4; IRK-4 Potassium channel; inwardly rectifying subfamily J member 14; Kcnj14 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-434
Sequence
MGLARALRRLSGALEPGNSRAGDEEEAGAGLCRNGWAPGPVAGNRRRGRFVKKDGHCNVRFVNLGGQGARYLSDLFTTCVDVRWRWMCLLFSCSFLASWLLFGLTFWLIASLHGDLAAPPPPAPCFSQVASFLAAFLFALETQTSIGYGVRSVTEECPAAVAAVVLQCIAGCVLDAFVVGAVMAKMAKPKKRNETLVFSENAVVALRDRRLCLMWRVGNLRRSHLVEAHVRAQLLQPRVTPEGEYIPLDHQDVDVGFDGGTDRIFLVSPITIVHEIDSASPLYELGRAELARADFELVVILEGMVEATAMTTQCRSSYLPGELLWGHRFEPVLFQRGSQYEVDYRHFHRTYEVPGTPVCSAKELDERAEQASHSPKSSFPGSLAAFCYENELALSCCQEEDEEEDTKEGTSAETPDRAASPQALTPTLALTLPP
Sequence Length
434
Species
Rattus norvegicus (Rat)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47,609 Da
NCBI Official Full Name
ATP-sensitive inward rectifier potassium channel 14
NCBI Official Synonym Full Names
potassium inwardly-rectifying channel, subfamily J, member 14
NCBI Official Symbol
Kcnj14
NCBI Official Synonym Symbols
Kir2.4
NCBI Protein Information
ATP-sensitive inward rectifier potassium channel 14; IRK4; IRK-4; inward rectifier K(+) channel Kir2.4; potassium inwardly-rectifying channel J14; inwardly rectifying potassium channel Kir2.4; potassium channel, inwardly rectifying subfamily J member 14
UniProt Protein Name
ATP-sensitive inward rectifier potassium channel 14
UniProt Gene Name
Kcnj14
UniProt Synonym Gene Names
Irk4; IRK-4
UniProt Entry Name
IRK14_RAT

NCBI Description

inwardly rectifying K+ channel; involved in controlling excitability of motoneurons [RGD, Feb 2006]

Uniprot Description

Function: Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. KCNJ14 gives rise to low-conductance channels with a low affinity to the channel blockers Barium and Cesium.

Subcellular location: Membrane; Multi-pass membrane protein.

Tissue specificity: Expressed predominantly in motoneurons of cranial nerve motor nuclei within the general somatic and special visceral motor cell column. Ref.1

Sequence similarities: Belongs to the inward rectifier-type potassium channel (TC 1.A.2.1) family. KCNJ14 subfamily. [View classification]

Similar Products

Product Notes

The Kcnj14 kcnj14 (Catalog #AAA1047538) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-434. The amino acid sequence is listed below: MGLARALRRL SGALEPGNSR AGDEEEAGAG LCRNGWAPGP VAGNRRRGRF VKKDGHCNVR FVNLGGQGAR YLSDLFTTCV DVRWRWMCLL FSCSFLASWL LFGLTFWLIA SLHGDLAAPP PPAPCFSQVA SFLAAFLFAL ETQTSIGYGV RSVTEECPAA VAAVVLQCIA GCVLDAFVVG AVMAKMAKPK KRNETLVFSE NAVVALRDRR LCLMWRVGNL RRSHLVEAHV RAQLLQPRVT PEGEYIPLDH QDVDVGFDGG TDRIFLVSPI TIVHEIDSAS PLYELGRAEL ARADFELVVI LEGMVEATAM TTQCRSSYLP GELLWGHRFE PVLFQRGSQY EVDYRHFHRT YEVPGTPVCS AKELDERAEQ ASHSPKSSFP GSLAAFCYEN ELALSCCQEE DEEEDTKEGT SAETPDRAAS PQALTPTLAL TLPP. It is sometimes possible for the material contained within the vial of "ATP-sensitive inward rectifier potassium channel 14 (Kcnj14), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.