ATP-sensitive inward rectifier potassium channel 14 (Kcnj14) Recombinant Protein | Kcnj14 recombinant protein
Recombinant Mouse ATP-sensitive inward rectifier potassium channel 14 (Kcnj14)
Gene Names
Kcnj14; IRK4; Kir2.4; A930026G01Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ATP-sensitive inward rectifier potassium channel 14 (Kcnj14); Recombinant Mouse ATP-sensitive inward rectifier potassium channel 14 (Kcnj14); Kcnj14 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-434aa; full length protein
Sequence
MGLARALRRLSGALEPGNSRAGDEEEAGAGLCRNGWAPGPVAGSRRRGRFVKKDGHCNVR FVNLGGQGARYLSDLFTTCVDVRWRWMCLLFSCSFLASWLLFGLTFWLIASLHGDLAAPP PPAPCFSQVASFLAAFLFALETQTSIGYGVRSVTEECPAAVAAVVLQCIAGCVLDAFVVG AVMAKMAKPKKRNETLVFSENAVVALRDHRLCLMWRVGNLRRSHLVEAHVRAQLLQPRVT PEGEYIPLDHQDVDVGFDGGTDRIFLVSPITIVHEIDSASPLYELGRAELARADFELVVI LEGMVEATAMTTQCRSSYLPGELLWGHRFEPVLFQRGSQYEVDYRHFHRTYEVPGTPVCS AKELDERAEQASHSPKSSFPGSLTAFCYENELALSCCQEEDEEEDTKEGTSAETPERAAS PQALTPTLALTLPP
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Kcnj14 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
47,607 Da
NCBI Official Full Name
ATP-sensitive inward rectifier potassium channel 14
NCBI Official Synonym Full Names
potassium inwardly-rectifying channel, subfamily J, member 14
NCBI Official Symbol
Kcnj14
NCBI Official Synonym Symbols
IRK4; Kir2.4; A930026G01Rik
NCBI Protein Information
ATP-sensitive inward rectifier potassium channel 14
UniProt Protein Name
ATP-sensitive inward rectifier potassium channel 14
Protein Family
UniProt Gene Name
Kcnj14
UniProt Synonym Gene Names
Irk4; IRK-4
UniProt Entry Name
KCJ14_MOUSE
Uniprot Description
KCNJ14: Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. KCNJ14 gives rise to low-conductance channels with a low affinity to the channel blockers Barium and Cesium. Belongs to the inward rectifier-type potassium channel (TC 1.A.2.1) family. KCNJ14 subfamily.
Protein type: Membrane protein, multi-pass; Membrane protein, integral
Cellular Component: cell soma; dendrite; integral to membrane; integral to plasma membrane; membrane
Molecular Function: inward rectifier potassium channel activity; voltage-gated ion channel activity
Biological Process: ion transport; potassium ion import; potassium ion transport; transport
Research Articles on Kcnj14
Similar Products
Product Notes
The Kcnj14 kcnj14 (Catalog #AAA7017681) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-434aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Kcnj14 kcnj14 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGLARALRRL SGALEPGNSR AGDEEEAGAG LCRNGWAPGP VAGSRRRGRF VKKDGHCNVR FVNLGGQGAR YLSDLFTTCV DVRWRWMCLL FSCSFLASWL LFGLTFWLIA SLHGDLAAPP PPAPCFSQVA SFLAAFLFAL ETQTSIGYGV RSVTEECPAA VAAVVLQCIA GCVLDAFVVG AVMAKMAKPK KRNETLVFSE NAVVALRDHR LCLMWRVGNL RRSHLVEAHV RAQLLQPRVT PEGEYIPLDH QDVDVGFDGG TDRIFLVSPI TIVHEIDSAS PLYELGRAEL ARADFELVVI LEGMVEATAM TTQCRSSYLP GELLWGHRFE PVLFQRGSQY EVDYRHFHRT YEVPGTPVCS AKELDERAEQ ASHSPKSSFP GSLTAFCYEN ELALSCCQEE DEEEDTKEGT SAETPERAAS PQALTPTLAL TLPP. It is sometimes possible for the material contained within the vial of "ATP-sensitive inward rectifier potassium channel 14 (Kcnj14), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
