Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ATP-sensitive inward rectifier potassium channel 10 (Kcnj10) Recombinant Protein | Kcnj10 recombinant protein

Recombinant Rat ATP-sensitive inward rectifier potassium channel 10 (Kcnj10)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ATP-sensitive inward rectifier potassium channel 10 (Kcnj10); Recombinant Rat ATP-sensitive inward rectifier potassium channel 10 (Kcnj10); Recombinant ATP-sensitive inward rectifier potassium channel 10 (Kcnj10); ATP-sensitive inward rectifier potassium channel 10; ATP-sensitive inward rectifier potassium channel KAB-2 BIR10 Brain-specific inwardly rectifying K(+) channel 1; BIRK1 Inward rec; Kcnj10 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-379
Sequence
MTSVAKVYYSQTTQTESRPLVAPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFIDMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELGPPANHTPCVVQVHTLTGAFLFSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIRFSQHAVVAYHNGKLCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYVADFSLFDQVVKVASPGGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV
Sequence Length
379
Species
Rattus norvegicus (Rat)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42,480 Da
NCBI Official Full Name
ATP-sensitive inward rectifier potassium channel 10
NCBI Official Synonym Full Names
potassium inwardly-rectifying channel, subfamily J, member 10
NCBI Official Symbol
Kcnj10
NCBI Protein Information
ATP-sensitive inward rectifier potassium channel 10; BIR10; BIRK1; kir4.1; inward rectifier K(+) channel Kir4.1; brain-specific inwardly rectifying K(+) channel 1; ATP-sensitive inward rectifier potassium channel KAB-2; potassium channel, inwardly rectifying subfamily J member 10
UniProt Protein Name
ATP-sensitive inward rectifier potassium channel 10
UniProt Gene Name
Kcnj10
UniProt Synonym Gene Names
Kab-2; BIRK1
UniProt Entry Name
IRK10_RAT

NCBI Description

inwardly rectifying K+ channel; specifically expressed in brain [RGD, Feb 2006]

Uniprot Description

Kir4.1: May be responsible for potassium buffering action of glial cells in the brain. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by extracellular barium and cesium. Defects in KCNJ10 are the cause of seizures, sensorineural deafness, ataxia, mental retardation, and electrolyte imbalance (SESAMES). A complex disorder characterized by generalized seizures with onset in infancy, delayed psychomotor development, ataxia, sensorineural hearing loss, hypokalemia, metabolic alkalosis, and hypomagnesemia. Belongs to the inward rectifier-type potassium channel (TC 1.A.2.1) family. KCNJ10 subfamily.

Protein type: Channel, ligand-gated; Channel, potassium; Membrane protein, integral; Membrane protein, multi-pass

Cellular Component: microvillus; integral to plasma membrane; basolateral plasma membrane; apical plasma membrane; plasma membrane

Molecular Function: identical protein binding; protein binding; potassium channel activity; ATP-activated inward rectifier potassium channel activity; inward rectifier potassium channel activity; ATP binding; receptor binding

Biological Process: regulation of long-term neuronal synaptic plasticity; myelination in the central nervous system; response to glucocorticoid stimulus; membrane hyperpolarization; response to blue light; glutamate uptake during transmission of nerve impulse; response to mineralocorticoid stimulus; adult walking behavior; protein homotetramerization; L-glutamate import; regulation of membrane potential; potassium ion import; visual perception; optic nerve development; regulation of resting membrane potential; regulation of sensory perception of pain; inflammatory response; oligodendrocyte development; potassium ion homeostasis; potassium ion transport

Research Articles on Kcnj10

Similar Products

Product Notes

The Kcnj10 kcnj10 (Catalog #AAA948201) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-379. The amino acid sequence is listed below: MTSVAKVYYS QTTQTESRPL VAPGIRRRRV LTKDGRSNVR MEHIADKRFL YLKDLWTTFI DMQWRYKLLL FSATFAGTWF LFGVVWYLVA VAHGDLLELG PPANHTPCVV QVHTLTGAFL FSLESQTTIG YGFRYISEEC PLAIVLLIAQ LVLTTILEIF ITGTFLAKIA RPKKRAETIR FSQHAVVAYH NGKLCLMIRV ANMRKSLLIG CQVTGKLLQT HQTKEGENIR LNQVNVTFQV DTASDSPFLI LPLTFYHVVD ETSPLKDLPL RSGEGDFELV LILSGTVEST SATCQVRTSY LPEEILWGYE FTPAISLSAS GKYVADFSLF DQVVKVASPG GLRDSTVRYG DPEKLKLEES LREQAEKEGS ALSVRISNV. It is sometimes possible for the material contained within the vial of "ATP-sensitive inward rectifier potassium channel 10 (Kcnj10), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.