Potassium voltage-gated channel subfamily E member 1 Recombinant Protein | Kcne1 recombinant protein

Potassium voltage-gated channel subfamily E member 1

Cat. Num. AAA7042976

• Gene Names: Kcne1; m; Isk
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Potassium voltage-gated channel subfamily E member 1; Kcne1 recombinant protein

• Host: Cell Free Expression
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 1-130aa; full length protein
• Sequence: MALSNSTTVLPFLASLWQETDEPGGNMSADLARRSQLRDDSKLEALYILMVLGFFGFFTLGIMLSYIRSKKLEHSHDPFNVYIESDAWQEKGKALFQARVLESFRACYVIENQAAVEQPATHLPELKPLS
• Sequence Length: Full Length Protein

• Species: Rattus norvegicus (Rat)
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for Kcne1 recombinant protein

This is a recombinant transmembrane protein expressed in a cell-free expression system.

Product Categories/Family for Kcne1 recombinant protein

Transmembrane Protein

NCBI and Uniprot Product Information

• NCBI GI #: 6981124
• NCBI GeneID: 25471
• NCBI Accession #: NP_037105.1
• NCBI GenBank Nucleotide #: NM_012973.1
• UniProt Accession #: P15383
• Molecular Weight: 14,699 Da
• NCBI Official Full Name: potassium voltage-gated channel subfamily E member 1
• NCBI Official Synonym Full Names: potassium voltage-gated channel subfamily E regulatory subunit 1
• NCBI Official Symbol: Kcne1
• NCBI Official Synonym Symbols: m; Isk
• NCBI Protein Information: potassium voltage-gated channel subfamily E member 1
• UniProt Protein Name: Potassium voltage-gated channel subfamily E member 1
• Protein Family: Potassium voltage-gated channel subfamily
• UniProt Gene Name: Kcne1
• UniProt Entry Name: KCNE1_RAT

NCBI Description

beta subunit of the voltage-gated potassium channel complex; involved in modulating channel kinetics [RGD, Feb 2006]

Uniprot Description

KCNE1: Ancillary protein that assembles as a beta subunit with a voltage-gated potassium channel complex of pore-forming alpha subunits. Modulates the gating kinetics and enhances stability of the channel complex. Assembled with KCNQ1/KVLQT1 is proposed to form the slowly activating delayed rectifier cardiac potassium (IKs) channel. The outward current reaches its steady state only after 50 seconds. Assembled with KCNH2/HERG may modulate the rapidly activating component of the delayed rectifying potassium current in heart (IKr). Associates with KCNQ1/KVLQT1 and KCNH2/HERG. Expressed in heart, lung, kidney, testis, ovaries, small intestine, peripheral blood leukocytes. Not detected in pancreas, spleen, prostate and colon. Restrictively localized in the apical membrane portion of epithelial cells. Belongs to the potassium channel KCNE family.

Protein type: Channel, potassium; Membrane protein, integral

Cellular Component: apical plasma membrane; cell surface; endoplasmic reticulum; Golgi apparatus; lysosome; plasma membrane; voltage-gated potassium channel complex; Z disc

Molecular Function: delayed rectifier potassium channel activity; potassium channel regulator activity; protein binding; protein heterodimerization activity; telethonin binding; voltage-gated potassium channel activity

Biological Process: epithelial cell maturation; heart contraction; male gonad development; protein amino acid N-linked glycosylation; protein amino acid O-linked glycosylation