Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Potassium voltage-gated channel subfamily D member 1 protein Recombinant Protein | KCND1 recombinant protein

Recombinant human Potassium voltage-gated channel subfamily D member 1 protein

Gene Names
KCND1; KV4.1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Potassium voltage-gated channel subfamily D member 1 protein; Recombinant human Potassium voltage-gated channel subfamily D member 1 protein; KCND1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
410-647aa; Cytoplasmic Domain
Sequence
NFSRIYHQNQRADKRRAQQKVRLARIRLAKSGTTNAFLQYKQNGGLEDSGSGEEQALCVRNRSAFEQQHHHLLHCLEKTTCHEFTDELTFSEALGAVSPGGRTSRSTSVSSQPVGPGSLLSSCCPRRAKRRAIRLANSTASVSRGSMQELDMLAGLRRSHAPQSRSSLNAKPHDSLDLNCDSRDFVAAIISIPTPPANTPDESQPSSPGGGGRAGSTLRNSSLGTPCLFPETVKISSL
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for KCND1 recombinant protein
Pore-forming (alpha) subunit of voltage-gated rapidly inactivating A-type potassium channels. May contribute to I(To) current in heart and I(Sa) current in neurons. Channel properties are modulated by interactions with other alpha subunits and with regulatory subunits.
Product Categories/Family for KCND1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27.7 kDa
NCBI Official Full Name
potassium voltage-gated channel subfamily D member 1
NCBI Official Synonym Full Names
potassium voltage-gated channel, Shal-related subfamily, member 1
NCBI Official Symbol
KCND1
NCBI Official Synonym Symbols
KV4.1
NCBI Protein Information
potassium voltage-gated channel subfamily D member 1; shal-type potassium channel; voltage-gated potassium channel Kv4.1; voltage-gated potassium channel subunit Kv4.1
UniProt Protein Name
Potassium voltage-gated channel subfamily D member 1
UniProt Gene Name
KCND1
UniProt Entry Name
KCND1_HUMAN

NCBI Description

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shal-related subfamily, members of which form voltage-activated A-type potassium ion channels and are prominent in the repolarization phase of the action potential. This gene is expressed at moderate levels in all tissues analyzed, with lower levels in skeletal muscle. [provided by RefSeq, Jul 2008]

Uniprot Description

KCND1: Pore-forming (alpha) subunit of voltage-gated rapidly inactivating A-type potassium channels. May contribute to I(To) current in heart and I(Sa) current in neurons. Channel properties are modulated by interactions with other alpha subunits and with regulatory subunits. Belongs to the potassium channel family. D (Shal) (TC 1.A.1.2) subfamily. Kv4.1/KCND1 sub-subfamily.

Protein type: Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: Xp11.23

Cellular Component: voltage-gated potassium channel complex; cell soma; dendrite; plasma membrane; integral to membrane

Molecular Function: metal ion binding; delayed rectifier potassium channel activity

Biological Process: synaptic transmission; protein homooligomerization

Research Articles on KCND1

Similar Products

Product Notes

The KCND1 kcnd1 (Catalog #AAA1265518) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 410-647aa; Cytoplasmic Domain. The amino acid sequence is listed below: NFSRIYHQNQ RADKRRAQQK VRLARIRLAK SGTTNAFLQY KQNGGLEDSG SGEEQALCVR NRSAFEQQHH HLLHCLEKTT CHEFTDELTF SEALGAVSPG GRTSRSTSVS SQPVGPGSLL SSCCPRRAKR RAIRLANSTA SVSRGSMQEL DMLAGLRRSH APQSRSSLNA KPHDSLDLNC DSRDFVAAII SIPTPPANTP DESQPSSPGG GGRAGSTLRN SSLGTPCLFP ETVKISSL. It is sometimes possible for the material contained within the vial of "Potassium voltage-gated channel subfamily D member 1 protein, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.